| Clone Name | rbasd23b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RIR1_ENCCU (Q8SR37) Ribonucleoside-diphosphate reductase large c... | 28 | 7.7 |
|---|
>RIR1_ENCCU (Q8SR37) Ribonucleoside-diphosphate reductase large chain (EC| 1.17.4.1) (Ribonucleotide reductase) Length = 768 Score = 27.7 bits (60), Expect = 7.7 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = -2 Query: 204 VVDLASTRFGIVDHHQSIIYSVLFPIEVRTATIVFFGLY---KEGVYCKHVRASTRLVQV 34 V+DLA+ R VD QS+ + P + ++ F+G + K G+Y R T ++ Sbjct: 683 VIDLAADRQVFVDQSQSLNIFIAKPTYSQLTSMHFYGYHCGLKTGMYYLRTRPITSAIKF 742 Query: 33 XL*NRPATYT 4 + + A T Sbjct: 743 TVDKKLAEKT 752 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,543,526 Number of Sequences: 219361 Number of extensions: 674387 Number of successful extensions: 1506 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1506 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)