| Clone Name | rbasd23a22 |
|---|---|
| Clone Library Name | barley_pub |
>SYS_ARATH (Q39230) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 451 Score = 52.0 bits (123), Expect = 9e-07 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -2 Query: 489 ENYQREGGVEVPVVLRPFMLGIDFLPFKRPLDSKQAAADSKPNKSK 352 ENYQRE GV++P VL+PFM G FLPFK +K AD+K KSK Sbjct: 409 ENYQREDGVDIPEVLQPFMGGETFLPFK----AKPVVADTKGKKSK 450
>SYSC_SCHPO (O14018) Seryl-tRNA synthetase, cytoplasmic (EC 6.1.1.11)| (Serine--tRNA ligase) (SerRS) Length = 450 Score = 39.7 bits (91), Expect = 0.004 Identities = 19/41 (46%), Positives = 23/41 (56%) Frame = -2 Query: 489 ENYQREGGVEVPVVLRPFMLGIDFLPFKRPLDSKQAAADSK 367 ENYQ GV VP VL+P+M G FLPF + L + K Sbjct: 409 ENYQTPDGVNVPKVLQPYMGGKTFLPFTKELPKNSTSKKGK 449
>SYS_HELAN (O81983) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 438 Score = 36.6 bits (83), Expect = 0.037 Identities = 17/31 (54%), Positives = 21/31 (67%) Frame = -2 Query: 489 ENYQREGGVEVPVVLRPFMLGIDFLPFKRPL 397 ENYQ E GV +P VL+PFM G FL F + + Sbjct: 406 ENYQTEKGVAIPEVLQPFMGGKTFLDFLKKI 436
>SYSC_YEAST (P07284) Seryl-tRNA synthetase, cytoplasmic (EC 6.1.1.11)| (Serine--tRNA ligase) (SerRS) Length = 462 Score = 35.4 bits (80), Expect = 0.082 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -2 Query: 489 ENYQREGGVEVPVVLRPFMLG-IDFLPFKRPLDSKQAAADSKPNKS 355 ENYQ E G+ VP VLR ++ G +FLPF L ++ K K+ Sbjct: 417 ENYQTEDGLVVPEVLRKYIPGEPEFLPFVNELPKNSTSSKDKKKKN 462
>SYS_METAC (Q8TIU3) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 421 Score = 35.0 bits (79), Expect = 0.11 Identities = 16/24 (66%), Positives = 20/24 (83%), Gaps = 1/24 (4%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGID 421 ENYQRE G VE+P VLRP+M G++ Sbjct: 393 ENYQREDGSVEIPEVLRPYMGGVE 416
>SYS_ERWCT (Q6D3V0) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 431 Score = 33.9 bits (76), Expect = 0.24 Identities = 14/26 (53%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ+ +G +E+P VLRP+M G++F+ Sbjct: 405 ENYQQADGRIEIPEVLRPYMGGLEFI 430
>SYS_METMA (Q8PYJ6) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 422 Score = 33.5 bits (75), Expect = 0.31 Identities = 16/24 (66%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGID 421 ENYQRE G VE+P VLRP+M G + Sbjct: 392 ENYQREDGSVEIPEVLRPYMGGAE 415
>SYS_SHIFL (P0A8L4) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 33.5 bits (75), Expect = 0.31 Identities = 14/26 (53%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ+ +G +EVP VLRP+M G++++ Sbjct: 404 ENYQQADGRIEVPEVLRPYMNGLEYI 429
>SYS_SALTY (P67563) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 33.5 bits (75), Expect = 0.31 Identities = 14/26 (53%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ+ +G +EVP VLRP+M G++++ Sbjct: 404 ENYQQADGRIEVPEVLRPYMNGLEYI 429
>SYS_SALTI (P67564) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 33.5 bits (75), Expect = 0.31 Identities = 14/26 (53%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ+ +G +EVP VLRP+M G++++ Sbjct: 404 ENYQQADGRIEVPEVLRPYMNGLEYI 429
>SYS_SALPA (Q5PGI6) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 33.5 bits (75), Expect = 0.31 Identities = 14/26 (53%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ+ +G +EVP VLRP+M G++++ Sbjct: 404 ENYQQADGRIEVPEVLRPYMNGLEYI 429
>SYS_ECOLI (P0A8L1) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 33.5 bits (75), Expect = 0.31 Identities = 14/26 (53%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ+ +G +EVP VLRP+M G++++ Sbjct: 404 ENYQQADGRIEVPEVLRPYMNGLEYI 429
>SYS_ECOL6 (P0A8L2) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 33.5 bits (75), Expect = 0.31 Identities = 14/26 (53%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ+ +G +EVP VLRP+M G++++ Sbjct: 404 ENYQQADGRIEVPEVLRPYMNGLEYI 429
>SYS_ECO57 (P0A8L3) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 33.5 bits (75), Expect = 0.31 Identities = 14/26 (53%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ+ +G +EVP VLRP+M G++++ Sbjct: 404 ENYQQADGRIEVPEVLRPYMNGLEYI 429
>SYS_ACIAD (Q6F8G5) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 425 Score = 33.1 bits (74), Expect = 0.41 Identities = 15/26 (57%), Positives = 20/26 (76%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQR +G +EVP VLRP+M G ++ Sbjct: 399 ENYQRADGAIEVPEVLRPYMGGATYI 424
>SYS_PHOLL (Q7N6E7) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 429 Score = 32.7 bits (73), Expect = 0.53 Identities = 13/26 (50%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ+ +G +E+P VLRP+M G++++ Sbjct: 403 ENYQQADGRIEIPEVLRPYMGGLEYI 428
>SYS_IDILO (Q5R0B0) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 32.0 bits (71), Expect = 0.91 Identities = 15/26 (57%), Positives = 20/26 (76%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGIDFL 415 ENYQ+E G + VP VLRP+M G++ L Sbjct: 403 ENYQQEDGSIVVPEVLRPYMGGVEVL 428
>SYSC_CANAL (Q9HGT6) Seryl-tRNA synthetase, cytoplasmic (EC 6.1.1.11)| (Serine--tRNA ligase) (SerRS) Length = 462 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -2 Query: 489 ENYQREGGVEVPVVLRPFMLG-IDFLPFKRPLDSKQAAADSKPNKS 355 ENYQ+E G+ +P VLR ++ G +F+P+ + L + K+ Sbjct: 417 ENYQKEDGLVIPEVLRKYIPGEPEFIPYIKELPKNTTSVKKAKGKN 462
>SYS_YERPS (Q66CJ9) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 31.6 bits (70), Expect = 1.2 Identities = 13/26 (50%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ+ +G ++VP VLRP+M G++++ Sbjct: 404 ENYQQADGRIQVPDVLRPYMGGLEYI 429
>SYS_YERPE (Q8ZGC4) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 31.6 bits (70), Expect = 1.2 Identities = 13/26 (50%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ+ +G ++VP VLRP+M G++++ Sbjct: 404 ENYQQADGRIQVPDVLRPYMGGLEYI 429
>SYS_STRA5 (P67566) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 425 Score = 31.2 bits (69), Expect = 1.6 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGIDFL 415 ENYQ E G V +P VLRP+M ID + Sbjct: 397 ENYQNEDGSVTIPEVLRPYMGNIDII 422
>SYS_STRA3 (P67565) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 425 Score = 31.2 bits (69), Expect = 1.6 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGIDFL 415 ENYQ E G V +P VLRP+M ID + Sbjct: 397 ENYQNEDGSVTIPEVLRPYMGNIDII 422
>SYS_MANSM (Q65SK3) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 31.2 bits (69), Expect = 1.6 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGIDFL 415 ENYQ E G V VP VLRP+M G++ + Sbjct: 403 ENYQNEDGSVTVPEVLRPYMGGLEVI 428
>SYS_XANAC (Q8PLY2) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 426 Score = 31.2 bits (69), Expect = 1.6 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGID 421 ENYQ +G ++VP VLRP+M GI+ Sbjct: 400 ENYQNADGSIDVPQVLRPYMGGIE 423
>SYS_PSEAE (Q9I0M6) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 426 Score = 31.2 bits (69), Expect = 1.6 Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ+ +G + VP VL+P+M GI+ + Sbjct: 400 ENYQQADGSIRVPEVLKPYMAGIEVI 425
>SYS_LACLA (Q9CEX2) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 423 Score = 30.8 bits (68), Expect = 2.0 Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGIDFL 415 ENYQ E G + VP VLRP+M G++ + Sbjct: 397 ENYQNEDGSITVPEVLRPYMGGLEVI 422
>SYS_BURPS (Q63RS1) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 433 Score = 30.8 bits (68), Expect = 2.0 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGID 421 ENYQ +G V VPV LRP+M G++ Sbjct: 401 ENYQNADGSVTVPVALRPYMGGVE 424
>SYS_BURMA (Q62HY1) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 433 Score = 30.8 bits (68), Expect = 2.0 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGID 421 ENYQ +G V VPV LRP+M G++ Sbjct: 401 ENYQNADGSVTVPVALRPYMGGVE 424
>SYS_DESVH (Q72FH6) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 424 Score = 30.4 bits (67), Expect = 2.7 Identities = 15/24 (62%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGID 421 ENYQ+E G V VP VLRP+M G++ Sbjct: 397 ENYQQEDGSVIVPEVLRPYMGGLE 420
>SYS_RHILO (Q98LC8) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 434 Score = 29.6 bits (65), Expect = 4.5 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGI 424 ENYQ E G V +P VLRP+M G+ Sbjct: 406 ENYQNEDGSVTIPEVLRPYMGGL 428
>SYS_BURCE (Q9AEN2) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 433 Score = 29.6 bits (65), Expect = 4.5 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGID 421 ENYQ +G V VP VLRP+M G++ Sbjct: 401 ENYQNADGSVTVPEVLRPYMGGLE 424
>SYS_WIGBR (Q8D265) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 429 Score = 29.6 bits (65), Expect = 4.5 Identities = 12/26 (46%), Positives = 20/26 (76%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQ-REGGVEVPVVLRPFMLGIDFL 415 ENYQ +EG ++VP +L+P+M G+ + Sbjct: 403 ENYQTKEGNIKVPKILQPYMDGLKLI 428
>SYS_LEGPL (Q5WZ31) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 426 Score = 29.6 bits (65), Expect = 4.5 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGIDFLPFK 406 ENYQ E G + +P L+P++ GID + K Sbjct: 398 ENYQDEHGNIHIPDALKPYLGGIDIISVK 426
>SYS_LEGPH (Q5ZY59) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 426 Score = 29.6 bits (65), Expect = 4.5 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGIDFLPFK 406 ENYQ E G + +P L+P++ GID + K Sbjct: 398 ENYQDEHGNIHIPDALKPYLGGIDIISVK 426
>SYS_LEGPA (Q5X7N0) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 426 Score = 29.6 bits (65), Expect = 4.5 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGIDFLPFK 406 ENYQ E G + +P L+P++ GID + K Sbjct: 398 ENYQDEHGNIHIPDALKPYLGGIDIISVK 426
>SYS1_ENTFA (Q839Q8) Seryl-tRNA synthetase 1 (EC 6.1.1.11) (Serine--tRNA ligase| 1) (SerRS 1) Length = 423 Score = 29.3 bits (64), Expect = 5.9 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 489 ENYQREGG-VEVPVVLRPFMLGI 424 ENYQ E G V +P VLRP+M G+ Sbjct: 397 ENYQNEDGTVTIPEVLRPYMGGL 419
>SYS_OCEIH (Q8EU77) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 424 Score = 29.3 bits (64), Expect = 5.9 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQREGG-VEVPVVLRPFMLGIDFL 415 ENYQ+E G V VP VLRP+M G + + Sbjct: 398 ENYQQEDGTVVVPEVLRPYMGGKEII 423
>SYS_BACHD (Q9KGN4) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 425 Score = 29.3 bits (64), Expect = 5.9 Identities = 13/24 (54%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -2 Query: 489 ENYQREGG-VEVPVVLRPFMLGID 421 ENYQ+E G + +P VLRP+M G++ Sbjct: 398 ENYQQEDGTIVIPEVLRPYMGGME 421
>SYS_GEOSL (Q74H55) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 422 Score = 29.3 bits (64), Expect = 5.9 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLGI 424 ENYQ+E G V +P VLRP+M G+ Sbjct: 396 ENYQQEDGSVVIPDVLRPYMGGL 418
>SYS_CHRVO (Q7NY99) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 427 Score = 29.3 bits (64), Expect = 5.9 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFM 433 ENYQ +G V VP VLRPFM Sbjct: 401 ENYQNADGSVTVPTVLRPFM 420
>SYS_STRP8 (Q8NZN7) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 425 Score = 28.9 bits (63), Expect = 7.7 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLG 427 ENYQ E G V +P VLRP+M G Sbjct: 397 ENYQNEDGSVTIPEVLRPYMGG 418
>SYS_STRP6 (Q5XAF1) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 425 Score = 28.9 bits (63), Expect = 7.7 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLG 427 ENYQ E G V +P VLRP+M G Sbjct: 397 ENYQNEDGSVTIPEVLRPYMGG 418
>SYS_STRP3 (Q8K635) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 425 Score = 28.9 bits (63), Expect = 7.7 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLG 427 ENYQ E G V +P VLRP+M G Sbjct: 397 ENYQNEDGSVTIPEVLRPYMGG 418
>SYS_STRP1 (Q99YE2) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 425 Score = 28.9 bits (63), Expect = 7.7 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -2 Query: 489 ENYQRE-GGVEVPVVLRPFMLG 427 ENYQ E G V +P VLRP+M G Sbjct: 397 ENYQNEDGSVTIPEVLRPYMGG 418
>SYS_HAEIN (P43833) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 429 Score = 28.9 bits (63), Expect = 7.7 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 489 ENYQR-EGGVEVPVVLRPFMLGIDFL 415 ENYQ +G + VP LRP+M G+D + Sbjct: 402 ENYQNADGSITVPEELRPYMGGLDVI 427 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,529,228 Number of Sequences: 219361 Number of extensions: 1229489 Number of successful extensions: 2975 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 2906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2973 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)