| Clone Name | rbasd22l17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YHDY_ECOLI (P45768) Inner membrane amino-acid ABC transporter pe... | 31 | 1.4 | 2 | TRSF_DROSI (Q24669) Female-specific protein transformer | 30 | 3.1 | 3 | ACSA1_ACEXY (P21877) Cellulose synthase 1 [Includes: Cellulose s... | 29 | 5.2 |
|---|
>YHDY_ECOLI (P45768) Inner membrane amino-acid ABC transporter permease protein| yhdY Length = 367 Score = 31.2 bits (69), Expect = 1.4 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 204 VGSSGAAGTLPWGLVLALG 260 + S G AG LPWG++LALG Sbjct: 165 IASVGIAGALPWGILLALG 183
>TRSF_DROSI (Q24669) Female-specific protein transformer| Length = 184 Score = 30.0 bits (66), Expect = 3.1 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +1 Query: 28 RSRDQNSRHKHYIQFSRSTNSSK---IYRGRREESSRPLRTAPTLFVLYTQM 174 +S D+ SRH+ + Q SRS N S+ R RR+ S P + Y Q+ Sbjct: 78 QSSDRGSRHRRHRQRSRSRNRSRSRSSERRRRQRSPHRYNPPPKIINYYVQV 129
>ACSA1_ACEXY (P21877) Cellulose synthase 1 [Includes: Cellulose synthase| catalytic domain [UDP-forming] (EC 2.4.1.12); Cyclic di-GMP-binding domain (Cellulose synthase 1 regulatory domain)] Length = 1550 Score = 29.3 bits (64), Expect = 5.2 Identities = 23/81 (28%), Positives = 35/81 (43%) Frame = +3 Query: 15 WGNVQIERPKLKT*ALHTILQINQLIKDLPRQEGGEQPSVTDRSYPLRPLHANA*IDQCH 194 WGN + +RP L +++ + +K L R G + RS P +PL NA D + Sbjct: 678 WGNYKADRPLL------SLMDMVLSVKGLFRSSG----DIVHRSSPTKPLAGNALSDDTN 727 Query: 195 GGEVGSSGAAGTLPWGLVLAL 257 GT+ +LAL Sbjct: 728 NPSRKERVLKGTVKMVSLLAL 748 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,335,878 Number of Sequences: 219361 Number of extensions: 906933 Number of successful extensions: 3078 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3076 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)