| Clone Name | rbasd23a05 |
|---|---|
| Clone Library Name | barley_pub |
>IBB_PHAAT (P83311) Bowman-Birk type proteinase inhibitor (TBPI-B)| Length = 80 Score = 32.0 bits (71), Expect = 0.42 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -2 Query: 169 NEAAMETRQSHRACCSMKRCSSSLPPRCGAPLPL 68 ++++ E +S +ACC C+ S+PP+C L L Sbjct: 6 HDSSDEPSESSKACCDHCACTKSIPPQCRCALRL 39
>IBB1_PHAAN (P01058) Bowman-Birk type proteinase inhibitor| Length = 82 Score = 30.4 bits (67), Expect = 1.2 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 169 NEAAMETRQSHRACCSMKRCSSSLPPRC 86 +E E +S + CC C+ S+PP+C Sbjct: 5 DETTDEPSESSKPCCDQCSCTKSMPPKC 32
>IBB4_DOLAX (P01059) Bowman-Birk type proteinase inhibitor DE-4| Length = 76 Score = 30.4 bits (67), Expect = 1.2 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -2 Query: 154 ETRQSHRACCSMKRCSSSLPPRC 86 E+ +S + CC + C+ S+PP+C Sbjct: 7 ESSESSKPCCDLCTCTKSIPPQC 29
>IBB2_PHAVU (P01060) Bowman-Birk type proteinase inhibitor 2 (Bowman-Birk type| proteinase inhibitor II) Length = 79 Score = 29.3 bits (64), Expect = 2.7 Identities = 8/28 (28%), Positives = 19/28 (67%) Frame = -2 Query: 169 NEAAMETRQSHRACCSMKRCSSSLPPRC 86 ++++ + +S CC + C++S+PP+C Sbjct: 4 BBSSZZPSZSSPPCCBICVCTASIPPQC 31
>LCE1F_HUMAN (Q5T754) Late cornified envelope protein 1F (Late envelope protein| 6) Length = 118 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -2 Query: 157 METRQSHRACCSMKRCSSSLPPRCGAPLPLINFPPLC 47 M +QS + C +C+ PP+C P PP C Sbjct: 1 MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKC 37
>LCE1E_HUMAN (Q5T753) Late cornified envelope protein 1E (Late envelope protein| 5) Length = 118 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -2 Query: 157 METRQSHRACCSMKRCSSSLPPRCGAPLPLINFPPLC 47 M +QS + C +C+ PP+C P PP C Sbjct: 1 MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKC 37
>LCE1C_HUMAN (Q5T751) Late cornified envelope protein 1C (Late envelope protein| 3) Length = 118 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -2 Query: 157 METRQSHRACCSMKRCSSSLPPRCGAPLPLINFPPLC 47 M +QS + C +C+ PP+C P PP C Sbjct: 1 MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKC 37
>LCE1A_HUMAN (Q5T7P2) Late cornified envelope protein 1A (Late envelope protein| 1) Length = 110 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -2 Query: 157 METRQSHRACCSMKRCSSSLPPRCGAPLPLINFPPLC 47 M +QS + C +C+ PP+C P PP C Sbjct: 1 MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKC 37
>IBB_DOLBI (Q9S9E3) Horsegram inhibitor 1 (Horsegram inhibitor I) (Bowman-Birk| type proteinase inhibitor HGI-I) [Contains: Horsegram germinated inhibitor 1 (Horsegram germinated inhibitor I) (HGGI-I); Horsegram germinated inhibitor 2 (Horsegram germinated Length = 76 Score = 29.3 bits (64), Expect = 2.7 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -2 Query: 169 NEAAMETRQSHRACCSMKRCSSSLPPRC 86 +++ E +S + CC C+ S+PP+C Sbjct: 3 HQSTDEPSESSKPCCDQCTCTKSIPPQC 30
>IBBC2_SOYBN (P01063) Bowman-Birk type proteinase inhibitor C-II precursor| Length = 83 Score = 28.9 bits (63), Expect = 3.6 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 145 QSHRACCSMKRCSSSLPPRC 86 +S + CC + C++S+PP+C Sbjct: 16 ESSKPCCDLCMCTASMPPQC 35
>DB118_MACMU (Q95LI0) Beta-defensin 118 precursor (Defensin, beta 118)| (Epididymal secretory protein 13.6) (ESP13.6) Length = 123 Score = 28.9 bits (63), Expect = 3.6 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -2 Query: 205 CWEEXXHYL*Q--QNEAAMETRQSHRACC 125 CW H Q EA ET ++HRACC Sbjct: 27 CWNRSGHCRKQCKDGEAVKETCKNHRACC 55
>IBB2_PHAAN (P01061) Bowman-Birk type proteinase inhibitors I-A, I-B, and I-A'| Length = 78 Score = 28.9 bits (63), Expect = 3.6 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -2 Query: 166 EAAMETRQSHRACCSMKRCSSSLPPRC 86 +++ E +S CC + C+ S+PP+C Sbjct: 6 DSSDEPSESSHPCCDLCLCTKSIPPQC 32
>DLLA_BRARE (Q6DI48) Delta-like protein A precursor (DeltaA protein)| Length = 772 Score = 28.5 bits (62), Expect = 4.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 96 GSDDEHRFIEQHARCDCLVSIAASFC 173 G D+EH F E+ C C V +C Sbjct: 231 GCDEEHGFCEKPGECKCRVGFKGRYC 256
>IBB_VIGUN (P17734) Bowman-Birk type seed trypsin and chymotrypsin inhibitor| (BTCI) Length = 83 Score = 28.1 bits (61), Expect = 6.1 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -2 Query: 154 ETRQSHRACCSMKRCSSSLPPRC 86 + +S + CC C+ S+PP C Sbjct: 10 ZASZSSKPCCRZCACTKSIPPZC 32
>IBB_PHALU (P01056) Bowman-Birk type proteinase inhibitor| Length = 83 Score = 28.1 bits (61), Expect = 6.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -2 Query: 154 ETRQSHRACCSMKRCSSSLPPRC 86 + +S + CC C+ S+PP+C Sbjct: 10 ZPSZSSKPCCBHCACTKSIPPQC 32
>IBB_MEDSC (P80321) Bowman-Birk type proteinase inhibitor (MSTI)| Length = 62 Score = 28.1 bits (61), Expect = 6.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 151 TRQSHRACCSMKRCSSSLPPRC 86 T+ + ACC C+ S+PP+C Sbjct: 1 TKSTTTACCDFCPCTRSIPPQC 22
>HYPD_RHOCA (P26411) Hydrogenase expression/formation protein hypD| Length = 377 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 7/35 (20%) Frame = +3 Query: 3 HQRHYCVSHTHSLY-------VHNGGKFIRGKGAP 86 H C HTHS++ +H G +FI G G P Sbjct: 36 HIMEICGGHTHSIFRYGLDKLIHPGIEFIHGPGCP 70
>IBB3_DOLAX (P01057) Bowman-Birk type proteinase inhibitor DE-3| Length = 76 Score = 28.1 bits (61), Expect = 6.1 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 154 ETRQSHRACCSMKRCSSSLPPRC 86 E +S + CC C+ S+PP+C Sbjct: 8 EPSESSKPCCDECACTKSIPPQC 30
>MAK5_SCHPO (O74393) ATP-dependent RNA helicase mak5 (EC 3.6.1.-)| Length = 648 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 3 HQRHYCVSHTHSLYVHNGGKFIR 71 H HY V HT +YVH G+ R Sbjct: 460 HVIHYHVPHTADMYVHRSGRTAR 482
>HIS3_NITEU (Q82WM6) Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) (PRA-CH)| Length = 129 Score = 27.7 bits (60), Expect = 8.0 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -3 Query: 192 KXIIYSNKMKQQWRRDSHIGHAAR*SGVHHRCRPGVVLL 76 + + +S K+ W + GH + S +H C ++LL Sbjct: 48 EAVYWSRSRKKLWHKGEESGHTQKISAIHLDCDEDILLL 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,841,252 Number of Sequences: 219361 Number of extensions: 617546 Number of successful extensions: 1613 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1611 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)