| Clone Name | rbasd22k02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GUX1_HUMGT (P15828) Exoglucanase 1 precursor (EC 3.2.1.91) (Exog... | 30 | 1.9 | 2 | RPM1_CAEEL (Q17551) Ubiquitin ligase protein rpm-1 (EC 6.3.2.-) ... | 28 | 5.5 | 3 | GUX1_NEUCR (P38676) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoc... | 28 | 5.5 |
|---|
>GUX1_HUMGT (P15828) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoglucanase I)| (Exocellobiohydrolase I) (1,4-beta-cellobiohydrolase) (Beta-glucancellobiohydrolase) Length = 525 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 147 TIDVMLTYDSRRRRRSTPSGATMCYFQNKW 58 T+ +T DS R SG+T CY NKW Sbjct: 45 TVQASITLDSNWRWTHQVSGSTNCYTGNKW 74
>RPM1_CAEEL (Q17551) Ubiquitin ligase protein rpm-1 (EC 6.3.2.-)| (Pam/highwire/rpm-1 protein) (Regulator of presynaptic morphology protein 1) (Synapse defective protein 3) Length = 3766 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 42 LAGYYATYSGNSTSWLRTGSISSSFGCHM*ASH 140 L+G+ +T +G WL TGS+ + C + SH Sbjct: 1963 LSGHTSTSAGFLAKWLPTGSVVDASKCQLSLSH 1995
>GUX1_NEUCR (P38676) Exoglucanase 1 precursor (EC 3.2.1.91)| (Exocellobiohydrolase 1) (1,4-beta-cellobiohydrolase) Length = 516 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -3 Query: 147 TIDVMLTYDSRRRRRSTPSGATMCYFQNKWHS 52 T++ + D+ R SG+T CY NKW + Sbjct: 43 TLNTTMVLDANWRWTHATSGSTKCYTGNKWQA 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,567,871 Number of Sequences: 219361 Number of extensions: 308365 Number of successful extensions: 772 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 772 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)