| Clone Name | rbasd22j18 |
|---|---|
| Clone Library Name | barley_pub |
>U5S1_MOUSE (O08810) 116 kDa U5 small nuclear ribonucleoprotein component (U5| snRNP-specific protein, 116 kDa) (U5-116 kDa) (Elongation factor Tu GTP-binding domain protein 2) Length = 971 Score = 72.0 bits (175), Expect = 8e-13 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -3 Query: 498 EPAPIQHLAREFMVKTRRRKGMSEDVSINKFFDEAMMNELAQQTADINLMM 346 EP P HLAREFM+KTRRRKG+SEDVSI+KFFD+ M+ ELA+Q +N M Sbjct: 921 EPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM 971
>U5S1_HUMAN (Q15029) 116 kDa U5 small nuclear ribonucleoprotein component (U5| snRNP-specific protein, 116 kDa) (U5-116 kDa) (Elongation factor Tu GTP-binding domain protein 2) (hSNU114) Length = 972 Score = 72.0 bits (175), Expect = 8e-13 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -3 Query: 498 EPAPIQHLAREFMVKTRRRKGMSEDVSINKFFDEAMMNELAQQTADINLMM 346 EP P HLAREFM+KTRRRKG+SEDVSI+KFFD+ M+ ELA+Q +N M Sbjct: 922 EPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM 972
>SN114_YEAST (P36048) 114 kDa U5 small nuclear ribonucleoprotein component (GIN10| protein) Length = 1008 Score = 36.6 bits (83), Expect = 0.039 Identities = 15/23 (65%), Positives = 21/23 (91%) Frame = -3 Query: 498 EPAPIQHLAREFMVKTRRRKGMS 430 +PAPI L+R+F++KTRRRKG+S Sbjct: 955 KPAPINSLSRDFVMKTRRRKGIS 977
>ATM_NEUCR (Q7RZT9) Serine/threonine-protein kinase tel-1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase tel-1) (Telomere length regulation protein 1) (ATM homolog) Length = 2953 Score = 30.4 bits (67), Expect = 2.8 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +1 Query: 280 WK*YVPSAKGQWTIARASIIKLHHQVDICSLLRQLVHHGLVKELVDANILAHALPSPGLH 459 W P+A W + + HQ +++R VH GL K L ++ +L + L Sbjct: 2021 WNLPAPAATENWAVTVYKAYQSMHQASDINMVRSAVHDGLTKTL--KHLTGKSLNTLTLR 2078 Query: 460 HEL 468 H+L Sbjct: 2079 HQL 2081
>CEP76_PONPY (Q5RCP7) Centrosomal protein of 76 kDa (Cep76 protein)| Length = 658 Score = 30.0 bits (66), Expect = 3.6 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 498 EPAPIQHLAREFMVKTRRRKGMSEDV 421 E AP QHL+ E ++K RR+G+ +DV Sbjct: 39 ELAPDQHLSTEDLIKALRRRGIIDDV 64
>PTM3C_BUCBP (Q89A36) PTS system mannitol-specific EIICBA component (EIICBA-Mtl)| (EII-Mtl) [Includes: Mannitol permease IIC component (PTS system mannitol-specific EIIC component); Mannitol-specific phosphotransferase enzyme IIB component (EC 2.7.1.69) (P Length = 640 Score = 29.6 bits (65), Expect = 4.7 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 456 KTRRRKGMSEDVSINKFFDEAMMNELAQQTADINL 352 + R+R ++ +S+N F D A NEL++ + NL Sbjct: 438 RARKRNSNAKHLSLNSFLDNAFYNELSKYLVENNL 472
>GCAT_AERHY (P10480) Phosphatidylcholine-sterol acyltransferase precursor (EC| 2.3.1.43) (Glycerophospholipid-cholesterol acyltransferase) (GCAT) Length = 335 Score = 28.9 bits (63), Expect = 8.1 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 295 PSAKGQWTIARASIIKLHHQVDICSLLRQLVHHGLVK 405 PSA+ Q + AS + +H + +L RQL G+VK Sbjct: 180 PSARSQKVVEAASHVSAYHNQLLLNLARQLAPTGMVK 216 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,083,498 Number of Sequences: 219361 Number of extensions: 1421799 Number of successful extensions: 3272 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3272 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)