| Clone Name | rbasd22j06 |
|---|---|
| Clone Library Name | barley_pub |
>CWC22_MAGGR (Q52B63) Pre-mRNA-splicing factor CWC22| Length = 907 Score = 37.4 bits (85), Expect = 0.032 Identities = 21/54 (38%), Positives = 33/54 (61%) Frame = -3 Query: 480 NPSQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQNQ 319 +PS+S + ++RS+SP P R ++ + S SR +SRS S S +S +P Q Q Sbjct: 704 SPSRSVSRSISRSRSPAPIRGRSYSRSVSRSRSRSYSRSVSRSPTPPRRQAPAQ 757
>H6ST2_MOUSE (Q80UW0) Heparan-sulfate 6-O-sulfotransferase 2 (EC 2.8.2.-)| (HS6ST-2) (mHS6ST-2) (Fragment) Length = 538 Score = 35.0 bits (79), Expect = 0.16 Identities = 18/51 (35%), Positives = 32/51 (62%) Frame = -3 Query: 471 QSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQNQ 319 QS Q ++SQSP + QN NP+ ++ +++LS + S +P+ TQ +N+ Sbjct: 457 QSQSQGQSQSQSPGQNLSQNPNPNPNQNLTQNLSHNLTPSSNPNSTQRENR 507
>CCNL2_XENTR (Q5BKF8) Cyclin-L2| Length = 497 Score = 33.9 bits (76), Expect = 0.35 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = -3 Query: 471 QSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 343 QS + +RSQSP + Q+ +PS S+S SPSR +S SP Sbjct: 370 QSYSRSQSRSQSPKRRKSQSYSPSS---DSKSRSPSRSRSDSP 409
>CWC22_YARLI (Q6C8C5) Pre-mRNA-splicing factor CWC22| Length = 954 Score = 33.9 bits (76), Expect = 0.35 Identities = 19/45 (42%), Positives = 28/45 (62%) Frame = -3 Query: 474 SQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 340 S+S + L+R ++ +P R + + S SR SRS S SR S+SPS Sbjct: 830 SRSRSRSLSRDRTGSPPRGRRRSRSYSRSPSRSYSRSRSYSRSPS 874
>UAFA_STAS1 (Q4A0V8) Uro-adherence factor A precursor| Length = 2316 Score = 33.9 bits (76), Expect = 0.35 Identities = 22/55 (40%), Positives = 32/55 (58%) Frame = -3 Query: 486 TXNPSQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 322 T + S S + L+ SQS + S +L+ S+S QS SLS S SQS SL+ ++ Sbjct: 810 TTSESLSLSESLSTSQSLSLSHSLSLSESESTSQSLSLSTSESLSQSLSLSASES 864 Score = 30.8 bits (68), Expect = 3.0 Identities = 19/56 (33%), Positives = 34/56 (60%) Frame = -3 Query: 489 KTXNPSQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 322 ++ + S+S Q + SQS + S ++L+ S+S +S SLS S S S SL++ ++ Sbjct: 1721 ESLSTSESLRQSESLSQSLSLSASESLSASESISESESLSESESLSASESLSESES 1776 Score = 29.6 bits (65), Expect = 6.6 Identities = 16/56 (28%), Positives = 34/56 (60%) Frame = -3 Query: 489 KTXNPSQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 322 ++ + S+S + + S+S + S ++L+ S+S +S SLS SQS +L++ ++ Sbjct: 1301 ESLSESESLSESESLSESESLSASESLSESESLSESESLSARESLSQSEALSESES 1356
>SFR16_HUMAN (Q8N2M8) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) Length = 659 Score = 32.7 bits (73), Expect = 0.78 Identities = 19/45 (42%), Positives = 28/45 (62%) Frame = -3 Query: 474 SQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 340 S S + L RS+S +PS Q+ + S+SR QS S SP+R + P+ Sbjct: 486 SPSRSRSLTRSRSHSPSPSQSRSRSRSRSQSPSPSPAREKLTRPA 530
>PDE4A_DROME (Q9W4T4) cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I| (EC 3.1.4.17) (Learning/memory process protein) (Protein dunce) Length = 1209 Score = 32.7 bits (73), Expect = 0.78 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = -3 Query: 486 TXNPSQSXCQXLNRSQSPNPSRCQNLNPSQS--RCQSRSLSPSRCQSQSPSLTQCQNQ 319 + NP QS Q ++ +PNP++ N NP+Q+ RC CQ Q+ L + + Sbjct: 282 STNPCQSAVQNQGQNSNPNPNQNPNTNPNQNQQRCS--------CQPQTSPLPHIKEE 331
>CWC21_USTMA (Q4P0G6) Pre-mRNA-splicing factor CWC21| Length = 348 Score = 32.7 bits (73), Expect = 0.78 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 3/48 (6%) Frame = -3 Query: 474 SQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRC---QSQSPS 340 S+S + +RS+S + S + S+SR SRS SPSRC +S+SP+ Sbjct: 277 SRSRSRSRSRSRSRSRSPLSHSRSSRSRSPSRSRSPSRCASSRSRSPA 324
>RSP1_CAEEL (Q23121) Probable splicing factor, arginine/serine-rich 1| (RNA-binding protein srp-5) (CeSRp75) Length = 312 Score = 32.3 bits (72), Expect = 1.0 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = -3 Query: 474 SQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 340 S+S + +RS+SP P R + + S+SR +SRS S +S+SPS Sbjct: 228 SRSSSRSKSRSRSP-PKRSRRESKSKSRSRSRSRSADNRKSRSPS 271
>SFRS4_MOUSE (Q8VE97) Splicing factor, arginine/serine-rich 4| Length = 489 Score = 32.0 bits (71), Expect = 1.3 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -3 Query: 480 NPSQSXCQXLNRSQSPN-PSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 322 NP PN P+ ++ + S S+ +SRS SPSR S+SPS ++ ++ Sbjct: 432 NPEPRARSRSTSKSKPNVPAESRSRSKSASKTRSRSKSPSRSASRSPSRSRSRS 485
>SFRS6_HUMAN (Q13247) Splicing factor, arginine/serine-rich 6 (Pre-mRNA-splicing| factor SRP55) Length = 344 Score = 31.6 bits (70), Expect = 1.7 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = -3 Query: 474 SQSXCQXLNRSQSP---NPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 340 S+S + +RS SP PS+ ++++P R SRS S SR +S+S S Sbjct: 291 SKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRS 338
>SRBS1_MOUSE (Q62417) Sorbin and SH3 domain-containing protein 1 (Ponsin)| (c-Cbl-associated protein) (CAP) (SH3 domain protein 5) (SH3P12) Length = 1290 Score = 31.2 bits (69), Expect = 2.3 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 438 SPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQNQ 319 S +PSR ++P Q + Q R ++P R Q PSL C Q Sbjct: 1199 SSSPSRSATVSPQQPQAQQRRVTPDRSQ---PSLDLCSYQ 1235
>RSP3_CAEEL (Q9NEW6) Probable splicing factor, arginine/serine-rich 3 (CeSF2)| (CeSF2/ASF) Length = 258 Score = 30.8 bits (68), Expect = 3.0 Identities = 19/45 (42%), Positives = 26/45 (57%) Frame = -3 Query: 474 SQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 340 S+S R SP S ++ + S+SR +SRS S SR S+SPS Sbjct: 212 SRSRSPRAERRASPKYSPRRSRSRSRSRSRSRSRSASRSPSRSPS 256
>SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) (Clk4-associating SR-related protein) Length = 653 Score = 30.8 bits (68), Expect = 3.0 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -3 Query: 444 SQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 340 S S +PSR +++ S SR QSRS S S+ SQS S Sbjct: 476 SWSLSPSRSRSVTRSGSRSQSRSRSRSQSHSQSQS 510
>NCAP_CVCAE (Q04700) Nucleocapsid protein (N structural protein) (NC)| Length = 382 Score = 30.4 bits (67), Expect = 3.9 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 432 NPSRCQNLNPSQSRCQSRSLSPSRCQSQS 346 N SR + +PSQSR QSR+ S SR + QS Sbjct: 154 NQSRDNSRSPSQSRSQSRNRSQSRGRQQS 182
>SFRS4_HUMAN (Q08170) Splicing factor, arginine/serine-rich 4 (Pre-mRNA-splicing| factor SRP75) (SRP001LB) Length = 494 Score = 30.4 bits (67), Expect = 3.9 Identities = 17/55 (30%), Positives = 33/55 (60%) Frame = -3 Query: 486 TXNPSQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 322 T ++S + ++S+ PS ++ + S S+ +SRS S SR S+SPS ++ ++ Sbjct: 436 TNQETRSRSRSNSKSKPNLPSESRSRSKSASKTRSRSKSRSRSASRSPSRSRSRS 490
>SYNJ1_HUMAN (O43426) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) Length = 1575 Score = 30.0 bits (66), Expect = 5.0 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = -3 Query: 477 PSQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQN 322 PS S + S SP S CQ+ S+ S + PSR S++P Q+ Sbjct: 1032 PSSSSGLGTSPSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPSAQS 1083
>NKTR_HUMAN (P30414) NK-tumor recognition protein (Natural-killer cells| cyclophilin-related protein) (NK-TR protein) Length = 1462 Score = 30.0 bits (66), Expect = 5.0 Identities = 16/37 (43%), Positives = 27/37 (72%) Frame = -3 Query: 444 SQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLT 334 SQS +PSR ++ + ++SR ++RS+S S +S+S S T Sbjct: 1309 SQSRSPSRSRSKSETKSRHRTRSVSYSHSRSRSRSST 1345
>SFRS5_HUMAN (Q13243) Splicing factor, arginine/serine-rich 5 (Pre-mRNA-splicing| factor SRP40) (Delayed-early protein HRS) Length = 272 Score = 29.6 bits (65), Expect = 6.6 Identities = 19/50 (38%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Frame = -3 Query: 489 KTXNPSQSXCQXLNRSQSPNPSRCQ-NLNPSQSRCQSRSLSPSRCQSQSP 343 ++ + S+S + +RS+S + SR + + + S+SR +SRS S SR S+SP Sbjct: 185 RSRSRSRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRSKSRSVSRSP 234
>A36DE_DROME (Q9V3R1) Accessory gland protein Acp36DE precursor| Length = 912 Score = 29.6 bits (65), Expect = 6.6 Identities = 19/57 (33%), Positives = 29/57 (50%) Frame = -3 Query: 489 KTXNPSQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQNQ 319 ++ + SQS ++ Q+ S NP S QS+S S S+ +SQ S +Q Q Q Sbjct: 199 QSQSASQSESNASSQFQAQEQSNRLLENPPVSESQSQSESQSQSESQKQSQSQSQRQ 255
>GUX1_HUMGT (P15828) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoglucanase I)| (Exocellobiohydrolase I) (1,4-beta-cellobiohydrolase) (Beta-glucancellobiohydrolase) Length = 525 Score = 29.6 bits (65), Expect = 6.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 225 TIDVMLTYDSRRRRRSTPSGATMCYFQNKW 136 T+ +T DS R SG+T CY NKW Sbjct: 45 TVQASITLDSNWRWTHQVSGSTNCYTGNKW 74
>VE2_HPV17 (P36785) Regulatory protein E2| Length = 452 Score = 29.3 bits (64), Expect = 8.6 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = -3 Query: 444 SQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 340 S+SPN R + +R QSRSLS SR +S+S S Sbjct: 296 SRSPNRGRGGSSGGPTTRSQSRSLSRSRSRSRSRS 330
>SFRS5_RAT (Q09167) Splicing factor, arginine/serine-rich 5 (Pre-mRNA-splicing| factor SRP40) (Insulin-induced growth response protein CL-4) (Delayed-early protein HRS) Length = 269 Score = 29.3 bits (64), Expect = 8.6 Identities = 19/49 (38%), Positives = 33/49 (67%) Frame = -3 Query: 489 KTXNPSQSXCQXLNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 343 ++ + S+S + +RS+S + SR ++ + S+SR +SRS S SR S+SP Sbjct: 184 RSRSRSRSRTRSSSRSRSRSRSR-RSKSYSRSRSRSRSRSKSRSGSRSP 231 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,644,583 Number of Sequences: 219361 Number of extensions: 698568 Number of successful extensions: 4386 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3925 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)