| Clone Name | rbasd22i14 |
|---|---|
| Clone Library Name | barley_pub |
>GALA_MOUSE (P47212) Galanin precursor [Contains: Galanin; Galanin| message-associated peptide (GMAP)] Length = 124 Score = 31.6 bits (70), Expect = 2.0 Identities = 19/69 (27%), Positives = 30/69 (43%) Frame = -3 Query: 586 GFDSGSGRRKTMLSRGYILSKDALSRARAFDESHQLSGSAAAKAAELSRRLGLTDRVSAG 407 G + R T+ S GY+L A+ R+F + H L+G + RR G D Sbjct: 25 GMPAKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELQLEVEERRPGSVDVPLPE 84 Query: 406 VGAIRSVDE 380 +R++ E Sbjct: 85 SNIVRTIME 93
>GALA_BOVIN (P11242) Galanin precursor [Contains: Galanin; Galanin| message-associated peptide (GMAP)] Length = 123 Score = 31.2 bits (69), Expect = 2.6 Identities = 20/59 (33%), Positives = 29/59 (49%) Frame = -3 Query: 556 TMLSRGYILSKDALSRARAFDESHQLSGSAAAKAAELSRRLGLTDRVSAGVGAIRSVDE 380 T+ S GY+L AL R+F + H L+G + E R G DR A +R++ E Sbjct: 35 TLNSAGYLLGPHALDSHRSFQDKHGLAGKRELE-PEDEARPGSFDRPLAENNVVRTIIE 92
>LIN10_CAEEL (O17583) Protein lin-10 (Abnormal cell lineage protein 10)| Length = 982 Score = 30.8 bits (68), Expect = 3.4 Identities = 19/70 (27%), Positives = 31/70 (44%) Frame = -3 Query: 589 GGFDSGSGRRKTMLSRGYILSKDALSRARAFDESHQLSGSAAAKAAELSRRLGLTDRVSA 410 G D ++TM+ +L + L RAR + L S +KAA +++ RV A Sbjct: 582 GSVDKKKNSKETMVHEPAVLIEGVLFRARYLGSTQMLCESRGSKAARMAQAQEAVARVKA 641 Query: 409 GVGAIRSVDE 380 G ++ E Sbjct: 642 PEGDVQPSTE 651
>GALA_PIG (P07480) Galanin precursor [Contains: Galanin; Galanin| message-associated peptide (GMAP)] Length = 123 Score = 30.0 bits (66), Expect = 5.8 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = -3 Query: 556 TMLSRGYILSKDALSRARAFDESHQLSGSAAAKAAELSRRLGLTDRVSAGVGAIRSVDE 380 T+ S GY+L A+ R+F + + L+G + + +R G DR+ + AIR++ E Sbjct: 35 TLNSAGYLLGPHAIDNHRSFHDKYGLAGKRELEPEDEARPGGF-DRLQSEDKAIRTIME 92
>CWC25_ASPFU (Q4X1D7) Pre-mRNA-splicing factor cwc25| Length = 447 Score = 30.0 bits (66), Expect = 5.8 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -2 Query: 389 SGRDIPCYRDDQDRRHCHRKNRGQGYEHHRDEQLFLRRSYDAVRGSH 249 S RD R D+DR K+R Y+H + + RS RG+H Sbjct: 260 SERDRRADRGDEDRHSSRYKDRDDRYDHSTRRRSYADRSPSPRRGNH 306 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,545,897 Number of Sequences: 219361 Number of extensions: 1478253 Number of successful extensions: 3809 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3804 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5767334219 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)