| Clone Name | rbasd22i02 |
|---|---|
| Clone Library Name | barley_pub |
>CRDL1_RAT (Q76LD0) Chordin-like protein 1 precursor (Kohjirin)| Length = 447 Score = 35.4 bits (80), Expect = 0.16 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -2 Query: 312 FPCAHPLPTPGRCCPRVPGSDKEQSIDVTGSSLGQEAVAMPWAMLM 175 +PC +P G+CC P Q+ D GS G+E + + A+L+ Sbjct: 301 YPCKYPQKLDGKCCKVCPEEPPSQNFDSKGSFCGEETMPVYEAVLV 346
>CRDL1_MOUSE (Q920C1) Chordin-like protein 1 precursor (Neuralin) (Ventroptin)| Length = 447 Score = 34.3 bits (77), Expect = 0.35 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -2 Query: 312 FPCAHPLPTPGRCCPRVPGSDKEQSIDVTGSSLGQEAVAMPWAMLM 175 +PC +P G+CC P Q+ D GS G+E + + ++ M Sbjct: 301 YPCKYPQKIDGKCCKVCPEEPPSQNFDSKGSFCGEETMPVYESVFM 346
>TISD_HUMAN (P47974) Butyrate response factor 2 (TIS11D protein) (EGF-response| factor 2) (ERF-2) Length = 492 Score = 33.9 bits (76), Expect = 0.45 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = -2 Query: 303 AHPLPTPGRCCPRVPGSDKEQSIDVTGSSLGQEAVAMP 190 AHP P+PG C P+ PG+ GSS G A P Sbjct: 65 AHPAPSPGSCSPKFPGA-------ANGSSCGSAAAGGP 95
>TISD_MOUSE (P23949) Butyrate response factor 2 (TIS11D protein)| Length = 367 Score = 31.6 bits (70), Expect = 2.3 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -2 Query: 303 AHPLPTPGRCCPRVPGS 253 AHP+P+PG C P+ PG+ Sbjct: 36 AHPVPSPGSCSPKFPGA 52
>CRDL1_HUMAN (Q9BU40) Chordin-like protein 1 precursor (Neuralin) (Ventroptin)| Length = 450 Score = 30.4 bits (67), Expect = 5.0 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Frame = -2 Query: 312 FPCAHPLPTPGRCCPRVPGSDKE----QSIDVTGSSLGQEAVAMPWAMLM 175 +PC +P G+CC PG + QS D G G+E + + ++ M Sbjct: 300 YPCKYPQKIDGKCCKVCPGKKAKELPGQSFDNKGYFCGEETMPVYESVFM 349
>CHIA_ECOLI (P13656) Probable bifunctional chitinase/lysozyme precursor| [Includes: Chitinase (EC 3.2.1.14); Lysozyme (EC 3.2.1.17)] Length = 897 Score = 30.4 bits (67), Expect = 5.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 560 GGSTPYFSTPETKSEQSPCSAERRTPYSGIEDFSRQS 450 G TP TPET +P ++E TP + D+S Q+ Sbjct: 303 GAVTPVDPTPETPVTPTPDNSEPSTPADSVNDYSLQA 339
>ATG2_CANAL (Q59X11) Autophagy-related protein 2| Length = 1856 Score = 29.6 bits (65), Expect = 8.6 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -3 Query: 542 FSTPETKSEQSPCSAERRTPYSGIEDFSRQSK 447 FS P T S S SA R+TPY I+ SK Sbjct: 1014 FSEPSTSSSSSSSSATRQTPYVYIQPLDYYSK 1045 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,478,185 Number of Sequences: 219361 Number of extensions: 2066440 Number of successful extensions: 5446 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 5133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5445 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6484657212 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)