| Clone Name | rbasd22f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NU4M_APILI (P34853) NADH-ubiquinone oxidoreductase chain 4 (EC 1... | 27 | 10.0 |
|---|
>NU4M_APILI (P34853) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 447 Score = 27.3 bits (59), Expect = 10.0 Identities = 21/84 (25%), Positives = 46/84 (54%), Gaps = 11/84 (13%) Frame = -3 Query: 261 NRMKTNAL----NVSISYLRIQMF------WLMLQL-VVLSMYSRNIVLLTTWV*ESLME 115 N+MK N N+ I L + +F W+ + + +MYS +++LT W+ L+ Sbjct: 26 NKMKNNLNLIIGNLIIINLLLNLFNLNWIDWIYIFCNLSFNMYSYGLIMLTLWI-FGLIF 84 Query: 114 MAMNVNNVKVLSI*IMNVCSVILL 43 +++N N++ L + ++ + S++L+ Sbjct: 85 ISLNNNSLNCLFMNLLLMISLLLV 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,757,022 Number of Sequences: 219361 Number of extensions: 731179 Number of successful extensions: 1528 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1528 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)