| Clone Name | rbasd22e19 |
|---|---|
| Clone Library Name | barley_pub |
>KRA57_HUMAN (Q6L8G8) Keratin-associated protein 5-7 (Keratin-associated protein| 5.7) (Ultrahigh sulfur keratin-associated protein 5.7) (Keratin-associated protein 5-3) (Keratin-associated protein 5.3) Length = 165 Score = 37.0 bits (84), Expect = 0.047 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 9/61 (14%) Frame = -3 Query: 548 SCACSY*ASLFTRPPQAQCG--CCVSARAKACCF-------ACIAAGGSDTICKNTCCFP 396 SC CS + + CG CC S+ K CC C ++G + C+++CC P Sbjct: 89 SCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCCQSSCCKPCCCSSGCGSSCCQSSCCNP 148 Query: 395 C 393 C Sbjct: 149 C 149 Score = 32.3 bits (72), Expect = 1.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 494 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 378 CGC + K CC ++G + C+++CC PC S Sbjct: 90 CGCSQCSCYKPCC---CSSGCGSSCCQSSCCKPCCCQSS 125
>KRA59_HUMAN (P26371) Keratin-associated protein 5-9 (Keratin-associated protein| 5.9) (Ultrahigh sulfur keratin-associated protein 5.9) (Keratin, cuticle, ultrahigh sulfur 1) (Keratin, ultra high-sulfur matrix protein A) (UHS keratin A) (UHS KerA) Length = 169 Score = 37.0 bits (84), Expect = 0.047 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 11/62 (17%) Frame = -3 Query: 545 CACSY*ASLFTRPPQAQCGCCV-----SARAKACCFA------CIAAGGSDTICKNTCCF 399 C CS +P +QC CC S R +CC + C ++G + C+++CC Sbjct: 97 CQCSC-----CKPYCSQCSCCKPCCSSSGRGSSCCQSSCCKPCCSSSGCGSSCCQSSCCK 151 Query: 398 PC 393 PC Sbjct: 152 PC 153 Score = 30.0 bits (66), Expect = 5.8 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 494 CGCCVSARAKACCFACIAAGGSDTICKNTCCFP 396 CG C ++ C C ++G + C+ +CC P Sbjct: 72 CGSCGCSQCSCCKPCCCSSGCGSSCCQCSCCKP 104
>KRA52_HUMAN (Q701N4) Keratin-associated protein 5-2 (Keratin-associated protein| 5.2) (Ultrahigh sulfur keratin-associated protein 5.2) (Keratin-associated protein 5-8) (Keratin-associated protein 5.8) Length = 177 Score = 35.8 bits (81), Expect = 0.11 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -3 Query: 494 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 378 CG C +++ C C ++G + C+++CC PC S Sbjct: 108 CGSCGCSQSSCCKPCCCSSGCGSSCCQSSCCKPCCCQSS 146 Score = 33.9 bits (76), Expect = 0.40 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = -3 Query: 548 SCACSY*ASLFTRPPQAQCG--CCVSARAKACCFACIAAGGSDTICKNTCCFPC 393 SC CS + + CG CC S+ K CC C ++ C+++CC PC Sbjct: 110 SCGCSQSSCCKPCCCSSGCGSSCCQSSCCKPCC--CQSSCCVPVCCQSSCCKPC 161
>KR510_HUMAN (Q6L8G5) Keratin-associated protein 5-10 (Keratin-associated| protein 5.10) (Ultrahigh sulfur keratin-associated protein 5.10) Length = 202 Score = 35.4 bits (80), Expect = 0.14 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 494 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 378 CG C ++ CC C + G + C+++CC PC S Sbjct: 134 CGSCGCSQCN-CCKPCCCSSGCGSCCQSSCCNPCCCQSS 171
>KRA54_HUMAN (Q6L8H1) Keratin-associated protein 5-4 (Keratin-associated protein| 5.4) (Ultrahigh sulfur keratin-associated protein 5.4) Length = 288 Score = 35.0 bits (79), Expect = 0.18 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 494 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPC 393 CG C ++ C C ++G + C+++CC PC Sbjct: 191 CGSCGCSQCSCCKPCCCSSGCGSSCCQSSCCKPC 224 Score = 32.3 bits (72), Expect = 1.2 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 488 CCVSARAKACCFACIAAGGSDTICKNTCCFPC 393 CC S+ K CC + +G + C+++CC PC Sbjct: 244 CCQSSCCKPCCSS---SGCGSSCCQSSCCNPC 272 Score = 32.3 bits (72), Expect = 1.2 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -3 Query: 548 SCACSY*ASLFTRPPQAQCGCCVSARAKACCFACIAAGG-SDTICKNTCCFP 396 SC CS + +P GC S +CC C ++ G + C+++CC P Sbjct: 193 SCGCSQCSCC--KPCCCSSGCGSSCCQSSCCKPCCSSSGCGSSCCQSSCCKP 242
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 34.7 bits (78), Expect = 0.23 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 9/43 (20%) Frame = -3 Query: 494 CG--CCVSARAKACCF-------ACIAAGGSDTICKNTCCFPC 393 CG CC S+ K CC C ++G + C+++CC PC Sbjct: 129 CGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPC 171 Score = 33.1 bits (74), Expect = 0.68 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 10/62 (16%) Frame = -3 Query: 548 SCACSY*ASLFTRPPQAQCG--CCVSARAKACCF--------ACIAAGGSDTICKNTCCF 399 SC CS + + CG CC S+ K CC +C + GS + C+++CC Sbjct: 82 SCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCSQSSCCKPCSCSSGCGS-SCCQSSCCK 140 Query: 398 PC 393 PC Sbjct: 141 PC 142
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 34.7 bits (78), Expect = 0.23 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 9/43 (20%) Frame = -3 Query: 494 CG--CCVSARAKACCF-------ACIAAGGSDTICKNTCCFPC 393 CG CC S+ K CC C ++G + C+++CC PC Sbjct: 180 CGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPC 222 Score = 34.7 bits (78), Expect = 0.23 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -3 Query: 545 CACSY*ASLFTRPPQAQCGCCVSARAKACCF--ACIAAGGSDTICKNTCCFPC 393 C S S +P +Q CC +++ C C ++G + C+++CC PC Sbjct: 141 CGSSCCQSSCCKPSCSQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPC 193
>KRA99_HUMAN (Q9BYP9) Keratin-associated protein 9-9 (Keratin-associated protein| 9.9) (Ultrahigh sulfur keratin-associated protein 9.9) Length = 154 Score = 33.9 bits (76), Expect = 0.40 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -3 Query: 506 PQAQCGCCVSARAKACCF-ACIAAGGSDTICKNTCCFPCILA 384 P Q CCVS+ + CC AC +T C+ TCC P L+ Sbjct: 36 PCCQPSCCVSSCCQPCCRPACC----QNTCCRTTCCQPTCLS 73
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 33.9 bits (76), Expect = 0.40 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 503 QAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 378 Q+Q GCCV K C + +G S + C+ + C P S Sbjct: 260 QSQQGCCVPVCCKPVCCVPVCSGASTSCCQQSSCQPACCTTS 301
>KR10A_HUMAN (P60014) Keratin-associated protein 10-10 (Keratin-associated| protein 10.10) (High sulfur keratin-associated protein 10.10) (Keratin-associated protein 18-10) (Keratin-associated protein 18.10) Length = 251 Score = 33.5 bits (75), Expect = 0.52 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = -3 Query: 578 CSLALPP*RQSCACSY*ASLFTRPPQAQCGCCVSARAKACCFACIAAGGSDTICKNTCCF 399 CS + P Q +C + T P Q CCV +K+ C+ + +G S + C+ + C Sbjct: 119 CSESSPSCCQQSSCQ--PTCCTSSP-CQQACCVPVCSKSVCYVPVCSGASTSCCQQSSCQ 175 Query: 398 P 396 P Sbjct: 176 P 176
>KRA94_HUMAN (Q9BYQ2) Keratin-associated protein 9-4 (Keratin-associated protein| 9.4) (Ultrahigh sulfur keratin-associated protein 9.4) Length = 154 Score = 33.1 bits (74), Expect = 0.68 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -3 Query: 506 PQAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 396 P Q CCVS+ + CC T C+NTCC P Sbjct: 36 PCCQPSCCVSSCCQPCC--------RPTCCQNTCCQP 64
>KRA98_HUMAN (Q9BYQ0) Keratin-associated protein 9-8 (Keratin-associated protein| 9.8) (Ultrahigh sulfur keratin-associated protein 9.8) Length = 159 Score = 33.1 bits (74), Expect = 0.68 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -3 Query: 506 PQAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 396 P Q CCVS+ + CC T C+NTCC P Sbjct: 31 PCCQPSCCVSSCCQPCC--------RPTCCQNTCCQP 59
>KRA93_HUMAN (Q9BYQ3) Keratin-associated protein 9-3 (Keratin-associated protein| 9.3) (Ultrahigh sulfur keratin-associated protein 9.3) Length = 159 Score = 32.7 bits (73), Expect = 0.89 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 506 PQAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 396 P Q CCVS+ + CC +T C+ TCC P Sbjct: 31 PCCQPSCCVSSCCQPCCHPTCC---QNTCCRTTCCQP 64
>KR412_HUMAN (Q9BQ66) Keratin-associated protein 4-12 (Keratin-associated| protein 4.12) (Ultrahigh sulfur keratin-associated protein 4.12) Length = 201 Score = 32.3 bits (72), Expect = 1.2 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -3 Query: 545 CACSY*ASLFTRPPQAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFPC 393 C S S RP Q CC + C CI++ + C+++CC PC Sbjct: 116 CRPSCCVSSCCRPQCCQSVCCQPTCCRPSC--CISSSCCPSCCESSCCRPC 164
>KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-associated| protein 10.8) (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8) Length = 259 Score = 32.3 bits (72), Expect = 1.2 Identities = 20/67 (29%), Positives = 26/67 (38%) Frame = -3 Query: 578 CSLALPP*RQSCACSY*ASLFTRPPQAQCGCCVSARAKACCFACIAAGGSDTICKNTCCF 399 CS A P Q +C F+ QA CCV K C + +G S C+ + C Sbjct: 138 CSGASSPCCQQSSCQSACCTFSPCQQA---CCVPICCKPICCVPVCSGASSLCCQKSSCQ 194 Query: 398 PCILADS 378 P S Sbjct: 195 PACCTTS 201
>KRA51_HUMAN (Q6L8H4) Keratin-associated protein 5-1 (Keratin-associated protein| 5.1) (Ultrahigh sulfur keratin-associated protein 5.1) Length = 278 Score = 32.3 bits (72), Expect = 1.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 500 AQCGCCVSARAKACCFACIAAGGSDTICKNTCCFPC 393 +QC CC K CC ++G + C+++CC PC Sbjct: 235 SQCSCC-----KPCC---CSSGCGSSCCQSSCCKPC 262
>KR511_HUMAN (Q6L8G4) Keratin-associated protein 5-11 (Keratin-associated| protein 5.11) (Ultrahigh sulfur keratin-associated protein 5.11) Length = 156 Score = 32.3 bits (72), Expect = 1.2 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = -3 Query: 548 SCACSY*ASLFTRPPQAQCG--CCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 378 SC CS + CG CC S+ +K CC + C+++CC PC S Sbjct: 79 SCGCSQSNCCKPCCSSSGCGSFCCQSSCSKPCCC-------QSSCCQSSCCKPCCCQSS 130 Score = 30.4 bits (67), Expect = 4.4 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 515 TRPPQAQCGCCVSARAKACC---FACIAAGGSDTICKNTCCFP 396 ++P Q CC S+ K CC C ++ C+++CC P Sbjct: 107 SKPCCCQSSCCQSSCCKPCCCQSSCCQSSCFKPCCCQSSCCVP 149 Score = 30.4 bits (67), Expect = 4.4 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -3 Query: 494 CGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 378 CG C +++ C C ++G C+++C PC S Sbjct: 77 CGSCGCSQSNCCKPCCSSSGCGSFCCQSSCSKPCCCQSS 115
>KRA56_HUMAN (Q6L8G9) Keratin-associated protein 5-6 (Keratin-associated protein| 5.6) (Ultrahigh sulfur keratin-associated protein 5.6) Length = 129 Score = 31.6 bits (70), Expect = 2.0 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 494 CGCCVSARAKACCFACIAAGG-SDTICKNTCCFPC 393 CG C ++ +CC C + G + C+++CC PC Sbjct: 80 CGSCGCSQC-SCCKPCYCSSGCGSSCCQSSCCKPC 113
>KRA45_HUMAN (Q9BYR2) Keratin-associated protein 4-5 (Keratin-associated protein| 4.5) (Ultrahigh sulfur keratin-associated protein 4.5) Length = 186 Score = 31.6 bits (70), Expect = 2.0 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = -3 Query: 554 RQSCAC-SY*ASLFTRPPQAQCGCCVSARAKACCFA--CIAAGGSDTICKNTCCFPCILA 384 R +C C S S RP Q CC CC CI++ + C+++CC PC Sbjct: 97 RTTCCCPSCCVSSCCRPQCCQSVCC----QPTCCRPSYCISSCCHPSCCESSCCRPCCCV 152 Query: 383 DSVVAKM 363 V ++ Sbjct: 153 RPVCGRV 159
>Y1386_PASMU (Q9CL57) Hypothetical protein PM1386| Length = 112 Score = 31.2 bits (69), Expect = 2.6 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = -3 Query: 548 SCACSY*ASLFTRPPQAQCGC--CVSARAKACCFACIAAGGSDTICKNTC 405 +C C+ +S T+ A C C C+S + +C + I G IC TC Sbjct: 31 TCVCTSNSSRVTKSSFANCACNVCLSLASASCPKSLIPCGRESWICCITC 80
>KRA47_HUMAN (Q9BYR0) Keratin-associated protein 4-7 (Keratin-associated protein| 4.7) (Ultrahigh sulfur keratin-associated protein 4.7) Length = 210 Score = 31.2 bits (69), Expect = 2.6 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -3 Query: 545 CACSY*ASLFTRPPQAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFPC 393 C S S RP Q CC + C CI++ + C+++CC PC Sbjct: 120 CRPSCCVSRCCRPQCCQSVCCQPTCCRPSC--CISSCCRPSCCESSCCRPC 168
>NPT2B_HUMAN (O95436) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 690 Score = 30.8 bits (68), Expect = 3.4 Identities = 23/77 (29%), Positives = 30/77 (38%), Gaps = 4/77 (5%) Frame = -3 Query: 524 SLFTRPPQAQCGCCVSARAKACCFACIAAGGSDTICK-NTCCFPCILA---DSVVAKMEE 357 S FT Q +C CC +ACC C G C+ + CC A V K E Sbjct: 608 SKFTGCFQMRCCCCCRVCCRACCLLC----GCPKCCRCSKCCEDLEEAQEGQDVPVKAPE 663 Query: 356 MGANVAMEGEE*NDTPA 306 N+ + E + PA Sbjct: 664 TFDNITISREAQGEVPA 680
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 30.8 bits (68), Expect = 3.4 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -3 Query: 539 CSY*ASLFTRPPQAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 396 CS +S + Q CC S+ + C + +G S + C+ + C P Sbjct: 243 CSEDSSSCCQQSSCQPACCTSSPCQHACCVPVCSGASTSCCQQSSCQP 290
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 30.8 bits (68), Expect = 3.4 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 6/63 (9%) Frame = -3 Query: 548 SCACSY*ASLFTRPPQAQCGCCVSARAKACCFACIAAGGSD------TICKNTCCFPCIL 387 SC S P Q GC S C AC A+ CK CC P Sbjct: 45 SCVSSPCCQAACEPSPCQSGCTSSCTPSCCQPACCASSPCQQACCVPVCCKPVCCLPTCS 104 Query: 386 ADS 378 DS Sbjct: 105 KDS 107
>YDC9_SCHPO (Q10172) Hypothetical protein C25G10.09c in chromosome I| Length = 1794 Score = 30.8 bits (68), Expect = 3.4 Identities = 20/54 (37%), Positives = 25/54 (46%) Frame = +1 Query: 331 PSMATLAPISSILATTESARIQGKQQVFLHIVSEPPAAIQAKQHAFARALTQQP 492 PS+A P S AT S+ + Q F H+ S P A QH A AL+ P Sbjct: 1499 PSVAQQPPSSVAPATAPSSTLPPSQSSFAHVPSPAP---PAPQHPSAAALSSAP 1549
>PA_INCJJ (P13878) Polymerase acidic protein (RNA-directed RNA polymerase| subunit P2) Length = 709 Score = 30.4 bits (67), Expect = 4.4 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 2/87 (2%) Frame = -2 Query: 624 QDR*QQQKETMEGKRMLTGTTTLKAI-MCLLILSIAVHSTTASTVWLLRKRPGKSMLLCL 448 +D + +TMEG +L GT + + C+L T + + R PGK ++ + Sbjct: 412 EDYAEHLNKTMEG--VLQGTNCAREMGKCIL--------TVGALMTECRLFPGKIKVVPI 461 Query: 447 YCRRWLRHNMQEHLLFPL-YSCRFGCC 370 Y R R +MQE L P C FG C Sbjct: 462 YARSKERKSMQEGLPVPSEMDCLFGIC 488
>KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-associated| protein 10.4) (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4) Length = 401 Score = 30.4 bits (67), Expect = 4.4 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -3 Query: 503 QAQCGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 378 Q+Q GCCV K + +G S + C+ + C P S Sbjct: 312 QSQQGCCVPVCCKPVSCVPVCSGASSSCCQQSSCQPACCTTS 353 Score = 30.4 bits (67), Expect = 4.4 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = -3 Query: 497 QCGCCVSARAKACCFACIAAGGSDTICKNTCCFPCILADS 378 Q CC S+ + C C+ CK CC P DS Sbjct: 96 QLACCASSPCQQAC--CVPVCCKTVCCKPVCCVPVCCGDS 133
>KRA92_HUMAN (Q9BYQ4) Keratin-associated protein 9-2 (Keratin-associated protein| 9.2) (Ultrahigh sulfur keratin-associated protein 9.2) Length = 174 Score = 30.0 bits (66), Expect = 5.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 497 QCGCCVSARAKACCFACIAAGGSDTICKNTCCFP 396 Q CCVS+ + CC +T C+ TCC P Sbjct: 39 QPACCVSSCCQPCCRPTSC---QNTCCRTTCCQP 69
>THNX_HORVU (Q8H0Q5) Probable leaf thionin precursor [Contains: Probable leaf| thionin; Acidic protein] Length = 137 Score = 29.6 bits (65), Expect = 7.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 488 CCVSARAKACCFACIAAGGSDTICKNTC 405 CC + + C AC AGGS +C C Sbjct: 31 CCKNTTGRNCYNACHFAGGSRPVCATAC 58
>THN7_HORVU (Q42838) Thionin BTH7 precursor [Contains: Thionin BTH7; Acidic| protein] Length = 137 Score = 29.6 bits (65), Expect = 7.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 488 CCVSARAKACCFACIAAGGSDTICKNTC 405 CC + + C AC AGGS +C C Sbjct: 31 CCKNTTGRNCYNACRFAGGSRPVCATAC 58
>THN5_HORVU (P09617) Leaf-specific thionin precursor [Contains: Leaf-specific| thionin; Acidic protein] Length = 137 Score = 29.6 bits (65), Expect = 7.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 488 CCVSARAKACCFACIAAGGSDTICKNTC 405 CC + + C AC AGGS +C C Sbjct: 31 CCKNTTGRNCYNACRFAGGSRPVCATAC 58
>KRA44_HUMAN (Q9BYR3) Keratin-associated protein 4-4 (Keratin-associated protein| 4.4) (Ultrahigh sulfur keratin-associated protein 4.4) Length = 166 Score = 29.6 bits (65), Expect = 7.6 Identities = 20/70 (28%), Positives = 26/70 (37%), Gaps = 1/70 (1%) Frame = -3 Query: 584 RGCSLALPP*RQSCACSY*ASLFTRPPQAQCGCCVSARAKA-CCFACIAAGGSDTICKNT 408 +GC L C SY + R + CCVS+ + CC T C+ T Sbjct: 13 QGCGL-----ENCCRPSYCQTTCCRTTCCRPSCCVSSCCRPQCC--------QTTCCRTT 59 Query: 407 CCFPCILADS 378 CC P S Sbjct: 60 CCHPSCCVSS 69
>THAB_PAROL (Q91242) Thyroid hormone receptor alpha B (THR-alpha-B)| Length = 391 Score = 29.6 bits (65), Expect = 7.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 459 LLCLYCRRWLRHNMQEHLLFPLYSCRFGCC 370 + C C+ + R +Q++L P YSC++ CC Sbjct: 48 ITCEGCKGFFRRTIQKNL-HPSYSCKYDCC 76
>NPT2B_PONPY (Q5REV9) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 689 Score = 29.6 bits (65), Expect = 7.6 Identities = 22/77 (28%), Positives = 30/77 (38%), Gaps = 4/77 (5%) Frame = -3 Query: 524 SLFTRPPQAQCGCCVSARAKACCFACIAAGGSDTICK-NTCCFPCILA---DSVVAKMEE 357 S FT Q +C CC +ACC C G C+ + CC A V K + Sbjct: 607 SKFTGCFQMRCCCCCRVCCRACCLLC----GCPKCCRCSKCCEDLEEAHEGQDVPVKAPD 662 Query: 356 MGANVAMEGEE*NDTPA 306 N+ + E + PA Sbjct: 663 TFDNITISREAQGEVPA 679
>ASPM_FELCA (P62288) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 3461 Score = 29.6 bits (65), Expect = 7.6 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 341 RHWLPFLPS*QQPNRQEYRGNNKCSCILCRSHLRQYKQSNMLL 469 RHWL +L + R E K SC++ +S R++KQ M L Sbjct: 1403 RHWLAYLRRKRDQQRYEML---KSSCLIIQSVFRRWKQHKMRL 1442
>MTCD_TETTH (Q8WSW3) Cadmium metallothionein precursor (MT-Cd) (Cd-MT)| Length = 162 Score = 29.3 bits (64), Expect = 9.9 Identities = 13/39 (33%), Positives = 16/39 (41%), Gaps = 7/39 (17%) Frame = -3 Query: 497 QCGCCVSARAKACCF----ACIAAGGSDTICKN---TCC 402 Q CC AK CCF C ++ CK+ CC Sbjct: 60 QANCCCGVNAKPCCFDPNSGCCCVSKTNNCCKSDTKECC 98
>KR415_HUMAN (Q9BYQ5) Keratin-associated protein 4-15 (Keratin-associated| protein 4.15) (Ultrahigh sulfur keratin-associated protein 4.15) (Fragment) Length = 193 Score = 29.3 bits (64), Expect = 9.9 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = -3 Query: 545 CACSY*ASLFTRPPQAQCGCCVSARAK-ACCFACIAAGGSDTICKNTCCFPCILADS 378 C S S RP Q CC + +CC +C T C+ TCC P S Sbjct: 24 CRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCPSCCQT----TCCRTTCCRPSCCVSS 76
>KRA43_HUMAN (Q9BYR4) Keratin-associated protein 4-3 (Keratin-associated protein| 4.3) (Ultrahigh sulfur keratin-associated protein 4.3) (Fragment) Length = 98 Score = 29.3 bits (64), Expect = 9.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 488 CCVSARAKACCFACIAAGGSDTICKNTCCFP 396 CC+S+ + C CI++ + C+ TCC P Sbjct: 7 CCISSCCRPSC--CISSCCKPSCCQTTCCRP 35
>CYSP1_OSTOS (P25802) Cathepsin B-like cysteine proteinase 1 precursor (EC| 3.4.22.-) Length = 341 Score = 29.3 bits (64), Expect = 9.9 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 7/52 (13%) Frame = -3 Query: 527 ASLFTRPPQAQCGCC--VSARAKACCFACIAAGGSDTICKN-----TCCFPC 393 +SLF P QA CG C VS+ A CIA+ G+ + + +CC C Sbjct: 105 SSLFHIPDQANCGSCWAVSSAAAMSDRICIASKGAKQVLISAQDVVSCCTWC 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,386,539 Number of Sequences: 219361 Number of extensions: 2167960 Number of successful extensions: 6005 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 5564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5959 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)