| Clone Name | rbasd22e17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MURC_PARUW (Q6MBS8) UDP-N-acetylmuramate--L-alanine ligase (EC 6... | 30 | 4.5 | 2 | CYSJ_BLOFL (Q7VQH2) Sulfite reductase [NADPH] flavoprotein alpha... | 30 | 5.9 | 3 | TYRP1_AMBME (P55027) 5,6-dihydroxyindole-2-carboxylic acid oxida... | 30 | 5.9 | 4 | Y3064_ERWCT (Q6D2N1) UPF0209 protein ECA3064 | 29 | 7.8 | 5 | YAY7_SCHPO (Q10215) Hypothetical protein C4H3.07c in chromosome I | 29 | 7.8 |
|---|
>MURC_PARUW (Q6MBS8) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 454 Score = 30.0 bits (66), Expect = 4.5 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = -2 Query: 438 RATLLVLATRESQKRSVTGSSRGATPSTPTVRTLATAHAITLCSRGGI 295 RA LL L TR+ + +VTG+ T S+ TL A+ + + GGI Sbjct: 91 RAELLALLTRQKKSLAVTGTHGKTTTSSLLATTLLEANCDSSFAVGGI 138
>CYSJ_BLOFL (Q7VQH2) Sulfite reductase [NADPH] flavoprotein alpha-component (EC| 1.8.1.2) (SIR-FP) Length = 610 Score = 29.6 bits (65), Expect = 5.9 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 215 IDRRRWVQVCGLPGVHHLRYDMIGQGLARKSGKAL 111 ++R++ L VHHL +D+ G GL + G AL Sbjct: 251 LNRQKITSCNSLKDVHHLEFDISGSGLCYQPGDAL 285
>TYRP1_AMBME (P55027) 5,6-dihydroxyindole-2-carboxylic acid oxidase precursor| (EC 1.14.18.-) (DHICA oxidase) (Tyrosinase-related protein 1) (TRP-1) (TRP1) Length = 534 Score = 29.6 bits (65), Expect = 5.9 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -2 Query: 372 GATPSTPTVRTLATAHAITLCSRGGIFNTIISFDTSS*CAENPMSGYNQ-KGRY 214 G + P V+ L + LC G+F+T + SS N + GY++ G+Y Sbjct: 316 GGNVARPMVQRLPEPQDVALCLEVGLFDTPPFYSNSSESFRNTVEGYSEPSGKY 369
>Y3064_ERWCT (Q6D2N1) UPF0209 protein ECA3064| Length = 675 Score = 29.3 bits (64), Expect = 7.8 Identities = 25/85 (29%), Positives = 34/85 (40%), Gaps = 17/85 (20%) Frame = -3 Query: 476 CPLPEREAGYMVLEQLSSSWQQ-------ENRRSGR*LVLREGQRQVHRLCV-------- 342 CP A + +Q S Q E SG L L GQ+ H + V Sbjct: 411 CPAELTAAALKLAQQNGLSVQMSTAVSALEKTDSGWALTLSAGQQVNHAVVVLANGHHIT 470 Query: 341 --PLRRHMPSPCVQGEASLIPSYPL 273 P RH+P V+G+ S IP+ P+ Sbjct: 471 DWPQTRHLPGYAVRGQVSHIPTNPV 495
>YAY7_SCHPO (Q10215) Hypothetical protein C4H3.07c in chromosome I| Length = 171 Score = 29.3 bits (64), Expect = 7.8 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = -1 Query: 553 LRNEMLNAVKGFSASGQNGVFINSCFAHCQSERQDTWYSSNSPRLGNKRIAEAVGDW 383 L +E + GFS VF ++ +C+S R+ T S +LG K I G W Sbjct: 109 LSDEEFSKTYGFSKP----VFEDNVVVYCRSGRRSTTASDILTKLGYKNIGNYTGSW 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,828,617 Number of Sequences: 219361 Number of extensions: 1903879 Number of successful extensions: 5351 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5351 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)