| Clone Name | rbasd22e14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RS7_HORVU (Q949H0) 40S ribosomal protein S7 | 47 | 9e-06 | 2 | RS7_SECCE (Q9XET4) 40S ribosomal protein S7 | 46 | 3e-05 | 3 | RS7_ORYSA (Q8LJU5) 40S ribosomal protein S7 | 42 | 3e-04 | 4 | RS7_BRAOL (Q9XH45) 40S ribosomal protein S7 | 36 | 0.027 | 5 | RS7_AVIMR (Q9ZNS1) 40S ribosomal protein S7 | 34 | 0.080 | 6 | RS7_NEUCR (O43105) 40S ribosomal protein S7 | 31 | 0.88 | 7 | RS7_ICTPU (Q90YR7) 40S ribosomal protein S7 | 31 | 0.88 | 8 | RS7_CAEEL (Q23312) 40S ribosomal protein S7 | 31 | 0.88 | 9 | RS7_BRARE (P62084) 40S ribosomal protein S7 | 30 | 1.2 | 10 | NU4M_APILI (P34853) NADH-ubiquinone oxidoreductase chain 4 (EC 1... | 30 | 1.5 | 11 | RS7_XENLA (P02362) 40S ribosomal protein S7 (S8) | 30 | 2.0 | 12 | RS7_FUGRU (P50894) 40S ribosomal protein S7 | 30 | 2.0 | 13 | RS7_SCHPO (Q10101) 40S ribosomal protein S7 | 29 | 3.4 | 14 | RS7_ANOGA (P33514) 40S ribosomal protein S7 | 28 | 4.4 |
|---|
>RS7_HORVU (Q949H0) 40S ribosomal protein S7| Length = 191 Score = 47.4 bits (111), Expect = 9e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 330 AAVYRRLCGKDVVFEYPVAETA 265 +AVYRRLCGKDVVFEYPVAETA Sbjct: 170 SAVYRRLCGKDVVFEYPVAETA 191
>RS7_SECCE (Q9XET4) 40S ribosomal protein S7| Length = 192 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -1 Query: 327 AVYRRLCGKDVVFEYPVAETA 265 AVYRRLCGKDVV+EYPVAETA Sbjct: 172 AVYRRLCGKDVVYEYPVAETA 192
>RS7_ORYSA (Q8LJU5) 40S ribosomal protein S7| Length = 192 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/22 (77%), Positives = 21/22 (95%) Frame = -1 Query: 330 AAVYRRLCGKDVVFEYPVAETA 265 ++VYRRLCGKDVVF+YP+ ETA Sbjct: 171 SSVYRRLCGKDVVFDYPMTETA 192
>RS7_BRAOL (Q9XH45) 40S ribosomal protein S7| Length = 191 Score = 35.8 bits (81), Expect = 0.027 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -1 Query: 324 VYRRLCGKDVVFEYPVAE 271 VYR+L GKDVVFEYPVA+ Sbjct: 173 VYRKLTGKDVVFEYPVAD 190
>RS7_AVIMR (Q9ZNS1) 40S ribosomal protein S7| Length = 190 Score = 34.3 bits (77), Expect = 0.080 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 330 AAVYRRLCGKDVVFEYPVAE 271 A VYR+L GKDVVFE+P+ E Sbjct: 171 AGVYRKLSGKDVVFEFPLTE 190
>RS7_NEUCR (O43105) 40S ribosomal protein S7| Length = 202 Score = 30.8 bits (68), Expect = 0.88 Identities = 12/18 (66%), Positives = 17/18 (94%) Frame = -1 Query: 330 AAVYRRLCGKDVVFEYPV 277 +AVYRRL GK+V+FE+P+ Sbjct: 180 SAVYRRLTGKNVLFEFPL 197
>RS7_ICTPU (Q90YR7) 40S ribosomal protein S7| Length = 194 Score = 30.8 bits (68), Expect = 0.88 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 330 AAVYRRLCGKDVVFEYP 280 A VY++L GKDVVFE+P Sbjct: 174 AGVYKKLTGKDVVFEFP 190
>RS7_CAEEL (Q23312) 40S ribosomal protein S7| Length = 194 Score = 30.8 bits (68), Expect = 0.88 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 330 AAVYRRLCGKDVVFEYP 280 A+VYR+L GKDV FE+P Sbjct: 174 ASVYRKLTGKDVTFEFP 190
>RS7_BRARE (P62084) 40S ribosomal protein S7| Length = 194 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -1 Query: 330 AAVYRRLCGKDVVFEYP 280 A VY++L GKDV+FE+P Sbjct: 174 AGVYKKLTGKDVIFEFP 190
>NU4M_APILI (P34853) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 447 Score = 30.0 bits (66), Expect = 1.5 Identities = 25/109 (22%), Positives = 56/109 (51%), Gaps = 19/109 (17%) Frame = -3 Query: 271 NRMKTNAL----NVSISYLRIQMF------WLMLQL-VVLSMYSRNIVLLTTWV*ESLME 125 N+MK N N+ I L + +F W+ + + +MYS +++LT W+ L+ Sbjct: 26 NKMKNNLNLIIGNLIIINLLLNLFNLNWIDWIYIFCNLSFNMYSYGLIMLTLWI-FGLIF 84 Query: 124 MAMNVNNVKVLSI*IMNVCSV--------ILLHYCLSRYCVILLHFIVI 2 +++N N++ L + ++ + S+ +LL Y + ++L+ ++V+ Sbjct: 85 ISLNNNSLNCLFMNLLLMISLLLVFLSMNLLLFYLFYEFGLLLIFYLVV 133
>RS7_XENLA (P02362) 40S ribosomal protein S7 (S8)| Length = 194 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -1 Query: 330 AAVYRRLCGKDVVFEYP 280 + VY++L GKDVVFE+P Sbjct: 174 SGVYKKLTGKDVVFEFP 190
>RS7_FUGRU (P50894) 40S ribosomal protein S7| Length = 194 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -1 Query: 330 AAVYRRLCGKDVVFEYP 280 + VY++L GKDVVFE+P Sbjct: 174 SGVYKKLTGKDVVFEFP 190
>RS7_SCHPO (Q10101) 40S ribosomal protein S7| Length = 195 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = -1 Query: 330 AAVYRRLCGKDVVFEYPVA 274 ++VY +L GK+V FE+PVA Sbjct: 172 SSVYHKLTGKNVTFEFPVA 190
>RS7_ANOGA (P33514) 40S ribosomal protein S7| Length = 192 Score = 28.5 bits (62), Expect = 4.4 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = -1 Query: 330 AAVYRRLCGKDVVFEYP 280 A+VY++L G+DV FE+P Sbjct: 172 ASVYKKLTGRDVTFEFP 188 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,976,587 Number of Sequences: 219361 Number of extensions: 818579 Number of successful extensions: 1706 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1706 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)