| Clone Name | rbasd22b18 |
|---|---|
| Clone Library Name | barley_pub |
>SCNNC_XENLA (O13262) Amiloride-sensitive sodium channel beta-2-subunit| (Epithelial Na(+) channel beta-2 subunit) (Beta-2 ENAC) (Nonvoltage-gated sodium channel 1 beta-2 subunit) (SCNEB2) (Beta-2 NACH) Length = 646 Score = 96.3 bits (238), Expect = 2e-20 Identities = 44/52 (84%), Positives = 44/52 (84%) Frame = -3 Query: 157 LAWIXXXXXXXXRPQYADPPPTVSELVEAHTNPGFQHDDGNHVTEDIPGTPP 2 LAWI RPQYADPPPTVSELVEAHTNPGFQHDDGNHVTEDIPGTPP Sbjct: 575 LAWIRNRRQRRQRPQYADPPPTVSELVEAHTNPGFQHDDGNHVTEDIPGTPP 626
>SCNNB_XENLA (P51169) Amiloride-sensitive sodium channel beta-subunit| (Epithelial Na+ channel beta subunit) (Beta ENaC) (Nonvoltage-gated sodium channel 1 beta subunit) (SCNEB) (Beta NaCH) Length = 647 Score = 82.8 bits (203), Expect = 2e-16 Identities = 38/52 (73%), Positives = 40/52 (76%) Frame = -3 Query: 157 LAWIXXXXXXXXRPQYADPPPTVSELVEAHTNPGFQHDDGNHVTEDIPGTPP 2 LAW RPQY+DPPPTVSELVEAHTN GFQHDDG+HV DIPGTPP Sbjct: 576 LAWSRNRRQRRKRPQYSDPPPTVSELVEAHTNSGFQHDDGDHVPVDIPGTPP 627
>SCNNB_RABIT (O97742) Amiloride-sensitive sodium channel beta-subunit| (Epithelial Na+ channel beta subunit) (Beta ENaC) (Nonvoltage-gated sodium channel 1 beta subunit) (SCNEB) (Beta NaCH) Length = 641 Score = 49.7 bits (117), Expect = 2e-06 Identities = 26/48 (54%), Positives = 30/48 (62%), Gaps = 10/48 (20%) Frame = -3 Query: 115 QYADPPPTVSELVEAHTNPGFQHDDGNHVTE----------DIPGTPP 2 +YA PPPTV+ELVEAHTN GFQ D G+ + IPGTPP Sbjct: 571 RYAGPPPTVAELVEAHTNFGFQPDVGHRSPDAEAYPDEQALPIPGTPP 618
>SCNNB_CANFA (Q95165) Amiloride-sensitive sodium channel beta-subunit| (Epithelial Na+ channel beta subunit) (Beta ENaC) (Nonvoltage-gated sodium channel 1 beta subunit) (SCNEB) (Beta NaCH) (Fragment) Length = 88 Score = 48.1 bits (113), Expect = 6e-06 Identities = 27/48 (56%), Positives = 30/48 (62%), Gaps = 10/48 (20%) Frame = -3 Query: 115 QYADPPPTVSELVEAHTNPGFQ-------HDDGNHVTED---IPGTPP 2 +YA PPPTV+ELVEAHTN GFQ D G + E IPGTPP Sbjct: 41 RYAGPPPTVAELVEAHTNFGFQPDVARPGPDPGTYPDEQTLPIPGTPP 88
>SCNNB_HUMAN (P51168) Amiloride-sensitive sodium channel beta-subunit| (Epithelial Na+ channel beta subunit) (Beta ENaC) (Nonvoltage-gated sodium channel 1 beta subunit) (SCNEB) (Beta NaCH) (ENaCB) Length = 640 Score = 47.8 bits (112), Expect = 8e-06 Identities = 27/47 (57%), Positives = 30/47 (63%), Gaps = 10/47 (21%) Frame = -3 Query: 112 YADPPPTVSELVEAHTNPGFQHD-------DGNHVTED---IPGTPP 2 YA PPPTV+ELVEAHTN GFQ D G + +E IPGTPP Sbjct: 571 YAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPP 617
>SCNNB_RAT (P37090) Amiloride-sensitive sodium channel beta-subunit| (Epithelial Na+ channel beta subunit) (Beta ENaC) (Nonvoltage-gated sodium channel 1 beta subunit) (SCNEB) (Beta NaCH) Length = 638 Score = 45.8 bits (107), Expect = 3e-05 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 10/47 (21%) Frame = -3 Query: 112 YADPPPTVSELVEAHTNPGFQHDD----------GNHVTEDIPGTPP 2 Y PPPTV+ELVEAHTN GFQ D + T IPGTPP Sbjct: 569 YTGPPPTVAELVEAHTNFGFQPDTTSCRPNAEVYPDQQTLPIPGTPP 615
>SCNNB_MOUSE (Q9WU38) Amiloride-sensitive sodium channel beta-subunit| (Epithelial Na+ channel beta subunit) (Beta ENaC) (Nonvoltage-gated sodium channel 1 beta subunit) (SCNEB) (Beta NaCH) Length = 638 Score = 45.8 bits (107), Expect = 3e-05 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 10/47 (21%) Frame = -3 Query: 112 YADPPPTVSELVEAHTNPGFQHDD----------GNHVTEDIPGTPP 2 Y PPPTV+ELVEAHTN GFQ D + T IPGTPP Sbjct: 569 YTGPPPTVAELVEAHTNFGFQPDTTSCRPHGEVYPDQQTLPIPGTPP 615
>TNR7_HUMAN (P26842) Tumor necrosis factor receptor superfamily member 7| precursor (CD27L receptor) (T-cell activation antigen CD27) (T14) Length = 260 Score = 30.0 bits (66), Expect = 1.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 98 WWICVLRPLPSLSAVPDPR 154 WW+CVL L LSA P P+ Sbjct: 7 WWLCVLGTLVGLSATPAPK 25
>TMEPA_MOUSE (Q9D7R2) Transmembrane prostate androgen-induced protein (NEDD4 WW| domain-binding protein 4) Length = 260 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 103 PPPTVSELVEAHTNPGFQHDDGNHVTEDIPGT 8 PPPT SE++ + FQH N + + GT Sbjct: 206 PPPTYSEVIGHYPGSSFQHQQSNGPSSLLEGT 237 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,193,733 Number of Sequences: 219361 Number of extensions: 477294 Number of successful extensions: 1342 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1339 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)