| Clone Name | rbasd21m15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RAD50_PYRAB (Q9UZC8) DNA double-strand break repair rad50 ATPase | 32 | 1.1 | 2 | YIM0_YEAST (P40475) Hypothetical 61.8 kDa protein in KGD1-SIM1 i... | 30 | 5.4 | 3 | FTSH_RICPR (Q9ZEA2) Cell division protein ftsH homolog (EC 3.4.2... | 29 | 9.3 | 4 | FTSH_RICCN (Q92JJ9) Cell division protein ftsH homolog (EC 3.4.2... | 29 | 9.3 |
|---|
>RAD50_PYRAB (Q9UZC8) DNA double-strand break repair rad50 ATPase| Length = 880 Score = 32.3 bits (72), Expect = 1.1 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -2 Query: 442 GRKQGTSLKAPSLP-STESFVCKIRLAEAFISLEHPLVTKLRQEKIDYRAIKDMACEYQQ 266 GRK+G K + S E KI E + + KL++++ +YR +K EY+ Sbjct: 256 GRKKGLEEKIVQIERSIEEKKAKISELEEIVKD----IPKLQEKEKEYRKLKGFRDEYES 311 Query: 265 MLKLLRKAPFLGRWRAKPRSVDSFI 191 L+ L K L +W ++ ++++ I Sbjct: 312 KLRRLEKE--LSKWESELKAIEEVI 334
>YIM0_YEAST (P40475) Hypothetical 61.8 kDa protein in KGD1-SIM1 intergenic| region Length = 563 Score = 30.0 bits (66), Expect = 5.4 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -1 Query: 143 GWFLKFLDFTPILAVLCTNSF-SLFVACVLLHNT 45 GW + TP+ AVLCT++F SLF C+L +T Sbjct: 437 GWCISVK--TPLAAVLCTSAFASLFSNCILTFST 468
>FTSH_RICPR (Q9ZEA2) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 637 Score = 29.3 bits (64), Expect = 9.3 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = +3 Query: 177 HHHGTINESTDLGLARHLPKNGAFLRSLSICWYSQAISLIAR*S--IFS*RNFVTNGCSS 350 H I LG+ + LP+ + ++ S A+ + R + I RN VT+G SS Sbjct: 435 HKATIIPRGNALGMVQRLPETDEYSQNREQMESSIAVYMAGRVAEEIIFGRNKVTSGASS 494 Query: 351 DMKASANL 374 D+K + N+ Sbjct: 495 DIKGATNI 502
>FTSH_RICCN (Q92JJ9) Cell division protein ftsH homolog (EC 3.4.24.-)| Length = 637 Score = 29.3 bits (64), Expect = 9.3 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = +3 Query: 177 HHHGTINESTDLGLARHLPKNGAFLRSLSICWYSQAISLIAR*S--IFS*RNFVTNGCSS 350 H I LG+ + LP+ + ++ S A+ + R + I RN VT+G SS Sbjct: 435 HKATIIPRGNALGMVQRLPETDEYSQNREQMESSIAVYMAGRVAEEIIFGRNKVTSGASS 494 Query: 351 DMKASANL 374 D+K + N+ Sbjct: 495 DIKGATNI 502 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,845,529 Number of Sequences: 219361 Number of extensions: 1581400 Number of successful extensions: 3371 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3371 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)