| Clone Name | rbasd22a07 |
|---|---|
| Clone Library Name | barley_pub |
>TRXH2_ARATH (Q38879) Thioredoxin H-type 2 (TRX-H-2)| Length = 133 Score = 43.1 bits (100), Expect = 5e-04 Identities = 21/43 (48%), Positives = 30/43 (69%) Frame = -3 Query: 488 DELAEGCKDIPA*RRCXTFVLVKGGQEVSRVVGAKKDELDRKI 360 DEL + K+ TFVLVK G+E+ R++GAKKDEL++K+ Sbjct: 87 DELPDVAKEFNV-TAMPTFVLVKRGKEIERIIGAKKDELEKKV 128
>TRXH_PICMA (O65049) Thioredoxin H-type (TRX-H)| Length = 125 Score = 38.9 bits (89), Expect = 0.009 Identities = 15/33 (45%), Positives = 25/33 (75%) Frame = -3 Query: 437 TFVLVKGGQEVSRVVGAKKDELDRKIKTFISSS 339 TF+ +K G+ V +VVGAKKD+L+RK+ +++ Sbjct: 82 TFIFIKDGKAVDKVVGAKKDDLERKVAALAAAA 114
>TRXH_FAGES (Q96419) Thioredoxin H-type (TRX-H)| Length = 116 Score = 37.7 bits (86), Expect = 0.019 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -3 Query: 437 TFVLVKGGQEVSRVVGAKKDELDRKI 360 +FV++K GQEV R+VGA+KDEL KI Sbjct: 83 SFVILKEGQEVERIVGARKDELLHKI 108
>TRXH1_TOBAC (P29449) Thioredoxin H-type 1 (TRX-H1)| Length = 126 Score = 37.7 bits (86), Expect = 0.019 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -3 Query: 437 TFVLVKGGQEVSRVVGAKKDELDRKI 360 TFV +K G+EV RVVGAKK+EL + I Sbjct: 90 TFVFIKDGKEVDRVVGAKKEELQQTI 115
>TRXH2_TOBAC (Q07090) Thioredoxin H-type 2 (TRX-H2)| Length = 118 Score = 36.6 bits (83), Expect = 0.043 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -3 Query: 437 TFVLVKGGQEVSRVVGAKKDELDRKIKTFISSS 339 TF+ +K G+ V +VVGAKKDEL + I ISS+ Sbjct: 83 TFMFLKEGKIVDKVVGAKKDELQQTIAKHISST 115
>TRXH_BRARA (O64432) Thioredoxin H-type (TRX-H)| Length = 123 Score = 33.5 bits (75), Expect = 0.36 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = -3 Query: 488 DELAEGCKDIPA*RRCXTFVLVKGGQEVSRVVGAKKDELDRKI 360 DELA K+ + TFV +KG +++ +VVGA K+E++ K+ Sbjct: 73 DELATVAKEFDV-QAMPTFVYMKGEEKLDKVVGAAKEEIEAKL 114
>THIO_EMENI (P29429) Thioredoxin| Length = 109 Score = 33.1 bits (74), Expect = 0.48 Identities = 20/48 (41%), Positives = 28/48 (58%) Frame = -3 Query: 488 DELAEGCKDIPA*RRCXTFVLVKGGQEVSRVVGAKKDELDRKIKTFIS 345 DEL+E ++ R TF+L K GQ+VS VVGA L+ IK ++ Sbjct: 63 DELSEVAAELGI-RAMPTFLLFKDGQKVSDVVGANPGALEAGIKALLA 109
>TRXH5_ARATH (Q39241) Thioredoxin H-type 5 (TRX-H-5)| Length = 118 Score = 32.7 bits (73), Expect = 0.62 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 437 TFVLVKGGQEVSRVVGAKKDELDRKI 360 TFV +K G + RVVGA KDE++ K+ Sbjct: 83 TFVFMKEGNIIDRVVGAAKDEINEKL 108
>TRXL4_ARATH (Q8LDI5) Thioredoxin-like 4| Length = 118 Score = 32.3 bits (72), Expect = 0.81 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = -3 Query: 437 TFVLVKGGQEVSRVVGAKKDELDRKIKTFISSS 339 TF+ +K G + ++VGA DE+ +++ F+ SS Sbjct: 80 TFLFLKDGNAMDKLVGANPDEIKKRVDGFVQSS 112
>TRXH_ORYSA (Q42443) Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein 1)| Length = 122 Score = 32.3 bits (72), Expect = 0.81 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -3 Query: 437 TFVLVKGGQEVSRVVGAKKDELDRKIKTFISSS 339 TF+ +K G E +VVGA+KD+L I + ++ Sbjct: 84 TFLFIKDGAEADKVVGARKDDLQNTIVKHVGAT 116
>TRXH_BRAOL (P68176) Thioredoxin H-type (TRX-H) (Pollen coat protein)| Length = 123 Score = 32.0 bits (71), Expect = 1.1 Identities = 16/43 (37%), Positives = 28/43 (65%) Frame = -3 Query: 488 DELAEGCKDIPA*RRCXTFVLVKGGQEVSRVVGAKKDELDRKI 360 DELA ++ + TFV +KG +++ +VVGA K+E++ K+ Sbjct: 73 DELATVAQEFDV-QAMPTFVYMKGEEKLDKVVGAAKEEIEAKL 114
>TRXH1_BRANA (P68177) Thioredoxin H-type 1 (TRX-H-1)| Length = 123 Score = 32.0 bits (71), Expect = 1.1 Identities = 16/43 (37%), Positives = 28/43 (65%) Frame = -3 Query: 488 DELAEGCKDIPA*RRCXTFVLVKGGQEVSRVVGAKKDELDRKI 360 DELA ++ + TFV +KG +++ +VVGA K+E++ K+ Sbjct: 73 DELATVAQEFDV-QAMPTFVYMKGEEKLDKVVGAAKEEIEAKL 114
>TRXH_RICCO (Q43636) Thioredoxin H-type (TRX-H)| Length = 118 Score = 32.0 bits (71), Expect = 1.1 Identities = 14/33 (42%), Positives = 24/33 (72%) Frame = -3 Query: 437 TFVLVKGGQEVSRVVGAKKDELDRKIKTFISSS 339 TF+ +K G+ + +VVGAKKDEL + I ++++ Sbjct: 84 TFMFLKEGKIMDKVVGAKKDELQQTIAKHMATA 116
>TRXH4_ARATH (Q39239) Thioredoxin H-type 4 (TRX-H-4)| Length = 119 Score = 32.0 bits (71), Expect = 1.1 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 437 TFVLVKGGQEVSRVVGAKKDELDRKI 360 TFV +K G+ V ++VGA K++L KI Sbjct: 85 TFVFIKAGEVVDKLVGANKEDLQAKI 110
>TRXH2_BRANA (Q39362) Thioredoxin H-type 2 (TRX-H-2)| Length = 119 Score = 31.6 bits (70), Expect = 1.4 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 437 TFVLVKGGQEVSRVVGAKKDELDRKI 360 TFVL+K G V +VVGA+K++L I Sbjct: 85 TFVLIKDGNVVDKVVGARKEDLHATI 110
>TRXH1_ARATH (P29448) Thioredoxin H-type 1 (TRX-H-1)| Length = 114 Score = 30.8 bits (68), Expect = 2.4 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 437 TFVLVKGGQEVSRVVGAKKDELDRKI 360 TF+ +K G+ + +VVGAKKDEL I Sbjct: 84 TFMFLKEGKILDKVVGAKKDELQSTI 109
>CBIO1_TREDE (Q73R11) Putative cobalt import ATP-binding protein cbiO 1| Length = 489 Score = 30.0 bits (66), Expect = 4.0 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -3 Query: 443 CXTFVLVKGGQEVSRVVGAKKDELDRKIKTF 351 C +++ GG+ V + G KK+EL+ +++TF Sbjct: 459 CSRVLILSGGKIVKELCGEKKNELEMQLETF 489 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,582,658 Number of Sequences: 219361 Number of extensions: 1444977 Number of successful extensions: 3387 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 3313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3385 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)