| Clone Name | rbasd21i14 |
|---|---|
| Clone Library Name | barley_pub |
>RBBP5_HUMAN (Q15291) Retinoblastoma-binding protein 5 (RBBP-5)| (Retinoblastoma-binding protein RBQ-3) Length = 538 Score = 33.1 bits (74), Expect = 0.34 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 32 KTAALNLNLLPTEELITILNAKGNGDGKRKVHKRPKG 142 KT + L +P +E+ +L KG+G K+K RPKG Sbjct: 453 KTTNIELQGVPNDEVHPLLGVKGDGKSKKKQAGRPKG 489
>ATX2L_MOUSE (Q7TQH0) Ataxin-2-like protein| Length = 1049 Score = 31.2 bits (69), Expect = 1.3 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 86 LNAKGNGDGKRKVHKRPKGGGTNVRNYVLH*ASIHGW 196 +N+K NG+ K KV +R +GG +N +Y L +GW Sbjct: 213 MNSKVNGEHKEKVLQRWEGGDSNSDDYDLESDMSNGW 249
>ATX2L_HUMAN (Q8WWM7) Ataxin-2-like protein (Ataxin-2 domain protein)| (Ataxin-2-related protein) Length = 1075 Score = 31.2 bits (69), Expect = 1.3 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 86 LNAKGNGDGKRKVHKRPKGGGTNVRNYVLH*ASIHGW 196 +N+K NG+ K KV +R +GG +N +Y L +GW Sbjct: 215 MNSKVNGEHKEKVLQRWEGGDSNSDDYDLESDMSNGW 251
>CRCB2_LACPL (Q88ZT7) Protein crcB homolog 2| Length = 127 Score = 29.3 bits (64), Expect = 4.9 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -3 Query: 210 GHALCQPWMEA*WST*FLTLVPPPLGLLCTFLLPSPFPFAFNIVINSSVG 61 G +L W + W T + +V + L T LLP+ P + +IVI SVG Sbjct: 20 GLSLLVTWPQHFWITCLINIVGAFVLSLITNLLPARLPVSEDIVIGMSVG 69
>HELX_METJA (Q57742) Putative ATP-dependent helicase MJ0294 (EC 3.6.1.-)| Length = 841 Score = 29.3 bits (64), Expect = 4.9 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = -3 Query: 114 LPSPFPFAFNIVINSS 67 LPSP PFAFN+V+++S Sbjct: 796 LPSPSPFAFNLVVSAS 811
>DHR11_BOVIN (Q3ZBV9) Dehydrogenase/reductase SDR family member 11 precursor (EC| 1.-.-.-) Length = 255 Score = 28.5 bits (62), Expect = 8.4 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = -1 Query: 425 ICCCQAC*SEREQLKLDSAVVEI*SMCFLIRKLGA*RHPVPPP 297 IC +AC S RE+ D ++ I SMC H VPPP Sbjct: 122 ICTREACQSMRERKVDDGHIININSMC---------GHRVPPP 155
>CF23_DROME (Q01522) Chorion transcription factor Cf2, isoform III| Length = 514 Score = 28.5 bits (62), Expect = 8.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 240 LTRRIPGRQSSSPASSYIFWRW 305 +TR P R SSS +SS FW W Sbjct: 460 VTRSCPSRSSSSYSSSKSFWSW 481 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,368,783 Number of Sequences: 219361 Number of extensions: 1481487 Number of successful extensions: 3316 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3316 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)