| Clone Name | rbasd21h14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PFL_CLOPA (Q46266) Formate acetyltransferase (EC 2.3.1.54) (Pyru... | 30 | 3.7 |
|---|
>PFL_CLOPA (Q46266) Formate acetyltransferase (EC 2.3.1.54) (Pyruvate| formate-lyase) Length = 740 Score = 30.0 bits (66), Expect = 3.7 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +2 Query: 20 AYVYVAGRSIIILGPTVCLHVRVYNILLPYTNRKTLWWPYVPQSEKEHC--I*SIDDDLQ 193 A V + GRS++ LH + P N LW +P+S K+ C + + D +Q Sbjct: 327 AGVGIDGRSLVTKNSFRYLHTLINLGSAPEPNMTVLWSENLPESFKKFCAEMSILTDSIQ 386 Query: 194 YQN 202 Y+N Sbjct: 387 YEN 389 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,288,846 Number of Sequences: 219361 Number of extensions: 1020513 Number of successful extensions: 2754 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2754 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)