| Clone Name | rbasd21h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MTB_STRPU (Q27287) Metallothionein-B (MTB) | 32 | 2.1 | 2 | PEPX_STRA5 (Q8DXW0) Xaa-Pro dipeptidyl-peptidase (EC 3.4.14.11) ... | 31 | 4.6 | 3 | PEPX_STRA3 (Q8E3H8) Xaa-Pro dipeptidyl-peptidase (EC 3.4.14.11) ... | 31 | 4.6 | 4 | NCKX1_HUMAN (O60721) Sodium/potassium/calcium exchanger 1 (Na(+)... | 30 | 7.8 | 5 | MTA_STRPU (P04734) Metallothionein-A (MTA) | 30 | 7.8 |
|---|
>MTB_STRPU (Q27287) Metallothionein-B (MTB)| Length = 65 Score = 32.0 bits (71), Expect = 2.1 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = -1 Query: 295 CKYGSECGCLSGCCVVFCIVGRPVTDG*V--PCLVVLIGYCLH*CRCSTFPSCRDG 134 CK G+EC C C C +G+ DG C C C C + SC +G Sbjct: 9 CKEGNECACTGQDC---CTIGKCCKDGTCCGKCSNAACKTCADGCTCGSGCSCTEG 61
>PEPX_STRA5 (Q8DXW0) Xaa-Pro dipeptidyl-peptidase (EC 3.4.14.11) (X-Pro| dipeptidyl-peptidase) (X-prolyl-dipeptidyl aminopeptidase) (X-PDAP) Length = 761 Score = 30.8 bits (68), Expect = 4.6 Identities = 20/65 (30%), Positives = 29/65 (44%) Frame = -3 Query: 581 NGRVAGYGASPNHSYDFHSQASSGVASRGLSDGTYEYSRRVFGSVLNDVSRRADRQPVPY 402 NG V G P D ++ + SR L G Y + + ++LN+ S+ DRQ Y Sbjct: 383 NGLVCSPGGYPGEDLDVLTELTY---SRNLLAGDYIKNNDCYQALLNEQSKAIDRQSGDY 439 Query: 401 PSY*H 387 Y H Sbjct: 440 NQYWH 444
>PEPX_STRA3 (Q8E3H8) Xaa-Pro dipeptidyl-peptidase (EC 3.4.14.11) (X-Pro| dipeptidyl-peptidase) (X-prolyl-dipeptidyl aminopeptidase) (X-PDAP) Length = 761 Score = 30.8 bits (68), Expect = 4.6 Identities = 20/65 (30%), Positives = 29/65 (44%) Frame = -3 Query: 581 NGRVAGYGASPNHSYDFHSQASSGVASRGLSDGTYEYSRRVFGSVLNDVSRRADRQPVPY 402 NG V G P D ++ + SR L G Y + + ++LN+ S+ DRQ Y Sbjct: 383 NGLVCSPGGYPGEDLDVLTELTY---SRNLLAGDYIKNNDCYQALLNEQSKAIDRQSGDY 439 Query: 401 PSY*H 387 Y H Sbjct: 440 NQYWH 444
>NCKX1_HUMAN (O60721) Sodium/potassium/calcium exchanger 1| (Na(+)/K(+)/Ca(2+)-exchange protein 1) (Retinal rod Na-Ca+K exchanger) Length = 1099 Score = 30.0 bits (66), Expect = 7.8 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 5/79 (6%) Frame = +3 Query: 132 TPSLQLGKVLQRH*C---RQYPIRTTRHGT*PSVTGLPTMQKTTQQPDRHPHSLPYLHAC 302 TP+++ +Q H C + P T PS+T ++ + P P SLP LH Sbjct: 380 TPTVRAKLTMQVHHCVVVKPTPAMLTTPS--PSLTTALLPEELSPSPSVLPPSLPDLHP- 436 Query: 303 NGRYPDD--TTEGLRQQWL 353 G YP D + E RQ W+ Sbjct: 437 KGEYPPDLFSVEERRQGWV 455
>MTA_STRPU (P04734) Metallothionein-A (MTA)| Length = 64 Score = 30.0 bits (66), Expect = 7.8 Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = -1 Query: 295 CKYGSECGCLSGCCVVFCIVGRPVTDG*VPCLVVLIG---YCLH*CRCSTFPSCRDG 134 CK G EC C C C G DG C + C + C+C + SC +G Sbjct: 9 CKEGKECACFGQDC---CKTGECCKDG--TCCGICTNAACKCANGCKCGSGCSCTEG 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,345,962 Number of Sequences: 219361 Number of extensions: 2086481 Number of successful extensions: 4840 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4824 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7706249192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)