| Clone Name | rbasd21h02 |
|---|---|
| Clone Library Name | barley_pub |
>ULK1_HUMAN (O75385) Serine/threonine-protein kinase ULK1 (EC 2.7.11.1)| (Unc-51-like kinase 1) Length = 1050 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +3 Query: 297 CSGSXAPRGR--PWPAVRCGRSPPVP 368 CS S +P GR P+ + RCG S P+P Sbjct: 408 CSSSPSPSGRAGPFSSSRCGASVPIP 433
>TXD11_HUMAN (Q6PKC3) Thioredoxin domain-containing protein 11 (EF-hand-binding| protein 1) Length = 985 Score = 28.9 bits (63), Expect = 3.2 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +1 Query: 88 KLVFLVSLSPELENVYVHRHRHTVFVMYEDISSMYFRSAAGW-LE*KEAVIKIIRSHDG 261 KLV LV +VY+HRH +T V ++ + + W LE +E + + +R H G Sbjct: 309 KLVSLVHSG----SVYLHRHFNTSLVFPREVLNYTAENICKWALENQETLFRWLRPHGG 363
>YQT1_CAEEL (Q09313) Hypothetical protein F25B5.1| Length = 923 Score = 28.1 bits (61), Expect = 5.4 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 5/62 (8%) Frame = +1 Query: 25 KTACFTMHIRLSLFVYSLFAHKLVF---LVSLSPELENVYVHRHRHTVF--VMYEDISSM 189 KT+C T LF++SL AH +V LV+ S ++ ++ H H++ + +E +S Sbjct: 836 KTSCGTR-----LFIHSLTAHHIVIHTVLVTASKIEQHDFIVAHEHSMSQPIGFEFVSYK 890 Query: 190 YF 195 YF Sbjct: 891 YF 892
>SOX1_HUMAN (O00570) SOX-1 protein| Length = 387 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = -1 Query: 367 GTGGLRPQRTAGHGRPRGA*DPLHEHVQRRGRQRLHRH 254 G GG P RT H P H H Q +HR+ Sbjct: 218 GAGGAHPHRTPAHPHPH------HPHAHPHNPQPMHRY 249
>DYHC_HUMAN (Q14204) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein| heavy chain 1) (DHC1) (Dynein heavy chain 1, cytoplasmic 1) Length = 4646 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 23 EKRRASLCISDFRSLYIRCSHTSSSSWYRFLP 118 EK+ + SD R ++R HT++S+W +P Sbjct: 4361 EKKTRTDSTSDGRPAWMRTLHTTASNWLHLIP 4392
>COLQ_TORMA (Q03637) Acetylcholinesterase collagenic tail peptide precursor| (AChE Q subunit) Length = 471 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +1 Query: 94 VFLVSLSPELENVYVHRHRHTVFVMYEDISSMYFRSAAGWLE*KEAVIKIIRSH 255 +F+V ELE + + +D S+Y+R GWL + A I+ +R + Sbjct: 335 IFVVDSEDELEKL----NTENALAFRKDQKSLYYRDTVGWLPIQIAPIQQMRQN 384
>PP1RA_MACMU (Q5TM61) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 (MHC class I region proline-rich protein CAT53) Length = 940 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = -1 Query: 367 GTGGLRPQRTAGHGRPRGA*D---PLHEHVQRRGRQRLHR 257 G+GG RP GHG P G P H RG HR Sbjct: 842 GSGGHRPHEGPGHGGPHGHRPHDVPGHRGHDHRGPPHEHR 881
>DYHC_MOUSE (Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein| heavy chain 1) (DHC1) (Dynein heavy chain 1, cytoplasmic 1) Length = 4644 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 23 EKRRASLCISDFRSLYIRCSHTSSSSWYRFLP 118 EK+ + SD R ++R HT++S+W +P Sbjct: 4359 EKKARTDSTSDGRPAWMRTLHTTASNWLHLIP 4390 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,951,253 Number of Sequences: 219361 Number of extensions: 937273 Number of successful extensions: 2486 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2483 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)