| Clone Name | rbasd21f13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | XKR7_RAT (Q5GH56) XK-related protein 7 | 33 | 0.36 | 2 | SFR15_RAT (Q63627) Splicing factor, arginine/serine-rich 15 (CTD... | 30 | 4.0 | 3 | XKR7_MOUSE (Q5GH64) XK-related protein 7 | 29 | 5.2 | 4 | XKR7_PANTR (Q49LS1) XK-related protein 7 | 28 | 8.9 | 5 | XKR7_HUMAN (Q5GH72) XK-related protein 7 | 28 | 8.9 | 6 | RS10_DICDI (O77082) 40S ribosomal protein S10 | 28 | 8.9 |
|---|
>XKR7_RAT (Q5GH56) XK-related protein 7| Length = 580 Score = 33.1 bits (74), Expect = 0.36 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +3 Query: 264 SVDGEQSGAPDPEVVVPRDERPGLPPDPAVHPHREQ 371 +V GE++G P P V RPGLPP P P R + Sbjct: 488 AVGGERAGTPTPPVF---QVRPGLPPTPVARPLRTE 520
>SFR15_RAT (Q63627) Splicing factor, arginine/serine-rich 15 (CTD-binding| SR-like protein RA4) (Fragment) Length = 1048 Score = 29.6 bits (65), Expect = 4.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 279 QSGAPDPEVVVPRDERPGLPPDPAVHP 359 Q G P P + P +PG+PP P V P Sbjct: 284 QPGMPQPGMPQPGMPQPGMPPTPPVQP 310
>XKR7_MOUSE (Q5GH64) XK-related protein 7| Length = 580 Score = 29.3 bits (64), Expect = 5.2 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 264 SVDGEQSGAPDPEVVVPRDERPGLPPDPAVHPHREQ 371 +V GE++G P V RPGLPP P P R + Sbjct: 488 AVGGERAGTPTLPVF---QVRPGLPPTPVARPLRTE 520
>XKR7_PANTR (Q49LS1) XK-related protein 7| Length = 579 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 273 GEQSGAPDPEVVVPRDERPGLPPDPAVHPHREQ 371 GE++G P P V RPGLPP P R + Sbjct: 490 GERAGTPTPPVF---QVRPGLPPTPVARTLRTE 519
>XKR7_HUMAN (Q5GH72) XK-related protein 7| Length = 579 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 273 GEQSGAPDPEVVVPRDERPGLPPDPAVHPHREQ 371 GE++G P P V RPGLPP P R + Sbjct: 490 GERAGTPTPPVF---QVRPGLPPTPVARTLRTE 519
>RS10_DICDI (O77082) 40S ribosomal protein S10| Length = 153 Score = 28.5 bits (62), Expect = 8.9 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 343 IQPSTRTVSST*PAVSSCASATARYGASGTFDPTRN-GDHTE 465 + P+T ++ P+ + + T R GASG FDP+ N GD + Sbjct: 87 VVPATMKKQASRPSTYTRSEETKRTGASGDFDPSFNRGDRRQ 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,134,304 Number of Sequences: 219361 Number of extensions: 758064 Number of successful extensions: 2446 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2285 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2434 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)