| Clone Name | rbasd21f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EST_HEVBR (Q7Y1X1) Esterase precursor (EC 3.1.1.-) (Early nodule... | 61 | 7e-10 | 2 | FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51... | 52 | 5e-07 | 3 | RIP_RAT (Q4G2Y1) RPA-interacting protein | 30 | 2.2 | 4 | CCW12_YEAST (Q12127) Covalently-linked cell wall protein 12 prec... | 28 | 6.3 |
|---|
>EST_HEVBR (Q7Y1X1) Esterase precursor (EC 3.1.1.-) (Early nodule-specific| protein homolog) (Latex allergen Hev b 13) Length = 391 Score = 61.2 bits (147), Expect = 7e-10 Identities = 32/67 (47%), Positives = 35/67 (52%), Gaps = 7/67 (10%) Frame = -2 Query: 242 YNFXKNIRCGDPVLXGX-------SCXXPSKSVSWDGVHLXEAACKFIFDXIVDGALSDP 84 YNF CGD V SC PS V+WDG H EAA ++ FD I GA SDP Sbjct: 312 YNFSVTAPCGDTVTADDGTKIVVGSCACPSVRVNWDGAHYTEAANEYFFDQISTGAFSDP 371 Query: 83 PVPLRGA 63 PVPL A Sbjct: 372 PVPLNMA 378
>FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51)| (Alpha-L-fucoside fucohydrolase 2) (Alpha-1,2-fucosidase) (AtFXG1) Length = 372 Score = 51.6 bits (122), Expect = 5e-07 Identities = 26/55 (47%), Positives = 29/55 (52%), Gaps = 7/55 (12%) Frame = -2 Query: 242 YNFXKNIRCG-------DPVLXGXSCXXPSKSVSWDGVHLXEAACKFIFDXIVDG 99 YN+ K I CG V G C P K+V WDGVH +AA KFIFD I G Sbjct: 310 YNYNKGIGCGMKKIVKGKEVYIGKPCDEPDKAVVWDGVHFTQAANKFIFDKIAPG 364
>RIP_RAT (Q4G2Y1) RPA-interacting protein| Length = 219 Score = 29.6 bits (65), Expect = 2.2 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 13 IQNLINEHDAHCP-LPXXAPRKGTGGSERAPSTXWS 117 ++ +NEH AHCP +P + TGG+E PS S Sbjct: 176 LEGNVNEHSAHCPHIPEFSV---TGGTEEKPSLLMS 208
>CCW12_YEAST (Q12127) Covalently-linked cell wall protein 12 precursor (Protein| Alpha0.6) Length = 133 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +1 Query: 13 IQNLINEHDAHCPLPXXAPRKGTGGSERAPSTXWSKMNLQAA 138 + ++I ++ CPL AP+ GT + ST K AA Sbjct: 61 VDDVITQYTTWCPLTTEAPKNGTSTAAPVTSTEAPKNTTSAA 102 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,668,980 Number of Sequences: 219361 Number of extensions: 444892 Number of successful extensions: 876 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 876 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)