| Clone Name | rbasd20p15 |
|---|---|
| Clone Library Name | barley_pub |
>EBNA3_EBV (P12977) Epstein-Barr nuclear antigen 3 (EBV nuclear antigen 3)| (EBNA-3) (EBNA-3A) Length = 812 Score = 31.2 bits (69), Expect = 0.62 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 199 QIHYPPLERFLASGQAYPSQIHRQICFHPCPCSQPP 306 Q+ PP A G AYP +H Q PCP +Q P Sbjct: 310 QVPEPPTIHLAAQGMAYP--LHEQHGMAPCPVAQAP 343
>GLU2_MAIZE (P04706) Glutelin-2 precursor (Zein-gamma) (27 kDa zein)| (Alcohol-soluble reduced glutelin) (ASG) (Zein ZC2) Length = 223 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 202 IHYPPLERFLASGQAYPSQIHRQICF---HPCPCSQPP*ASGCCCL*LNHPSSC 354 +H PP YP+Q R HPCPC QP HPS C Sbjct: 70 VHVPPPVHLPPPPCHYPTQPPRPQPHPQPHPCPCQQP------------HPSPC 111
>RBFA_DEIRA (Q9RVX0) Ribosome-binding factor A| Length = 128 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 108 ARGRLQLERSAEGRLKLKPTVNF 40 ARGRLQ E SA R++ PT+ F Sbjct: 90 ARGRLQRELSAHVRMRRTPTLEF 112
>TRI42_HUMAN (Q8IWZ5) Tripartite motif protein 42| Length = 723 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 Query: 250 PSQIHRQICFHPCPCSQPP*ASGCCCL*LNHPS 348 P + R F C CS+ P CCC N P+ Sbjct: 43 PYKDERNCQFCHCTCSESPNCHWCCCSWANDPN 75
>NIFQ_RHOCA (P20629) Protein nifQ| Length = 180 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 194 RSRSTTHHWSAFWLPARPTLHRSIARF 274 RS T H W LP+RP L IA F Sbjct: 105 RSMETRHLWEDLGLPSRPWLSGMIAHF 131
>DNAA_BARQU (Q6G0V6) Chromosomal replication initiator protein dnaA| Length = 494 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 102 GRLQLERSAEGRLKLKPTVNFPRKWARSHHGTVV 1 GRL+L + +KL F R W +H+G+++ Sbjct: 49 GRLKLAEYSRNLVKLSVPTAFLRSWINNHYGSLL 82
>DNAA_BARHE (Q6G526) Chromosomal replication initiator protein dnaA| Length = 494 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 102 GRLQLERSAEGRLKLKPTVNFPRKWARSHHGTVV 1 GRL+L + +KL F R W +H+G+++ Sbjct: 49 GRLKLAEYSRNLVKLSVPTAFLRSWINNHYGSLL 82
>CRDL2_MOUSE (Q8VEA6) Chordin-like protein 2 precursor| Length = 426 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 262 HRQICFHPCPCSQPP*ASGCCC 327 HR C PCSQP +G CC Sbjct: 286 HRVTCPTQYPCSQPKKVAGKCC 307 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,562,158 Number of Sequences: 219361 Number of extensions: 416596 Number of successful extensions: 1032 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1031 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)