ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd21e04 |
|---|---|
| Clone Library Name | barley_pub |
>SFRS1_ARATH (O22315) Pre-mRNA-splicing factor SF2 (SR1 protein)| Length = 303 Score = 68.2 bits (165), Expect = 2e-11 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSKGYIRVKEYD 460 + DYT Y+DMKYA+KKLDDTEF+NAFS GY+RV+EYD Sbjct: 160 VVDYTCYEDMKYALKKLDDTEFRNAFSNGYVRVREYD 196
>RSP3_CAEEL (Q9NEW6) Probable splicing factor, arginine/serine-rich 3 (CeSF2)| (CeSF2/ASF) Length = 258 Score = 42.0 bits (97), Expect = 0.001 Identities = 17/36 (47%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSK-GYIRVKE 466 + ++T Y+D+KYA++KLDDT+F++ + YIRV+E Sbjct: 161 VVEFTRYEDVKYAVRKLDDTKFRSHEGETAYIRVRE 196
>SFRS9_MOUSE (Q9D0B0) Splicing factor, arginine/serine-rich 9| Length = 222 Score = 33.9 bits (76), Expect = 0.34 Identities = 15/34 (44%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSK-GYIRV 472 + +Y +DM+YA++KLDDT+F++ + YIRV Sbjct: 150 MVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRV 183
>SFRS9_RAT (Q5PPI1) Splicing factor, arginine/serine-rich 9| Length = 221 Score = 33.9 bits (76), Expect = 0.34 Identities = 15/34 (44%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSK-GYIRV 472 + +Y +DM+YA++KLDDT+F++ + YIRV Sbjct: 149 MVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRV 182
>SFRS9_HUMAN (Q13242) Splicing factor, arginine/serine-rich 9 (Pre-mRNA-splicing| factor SRp30C) Length = 221 Score = 33.9 bits (76), Expect = 0.34 Identities = 15/34 (44%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSK-GYIRV 472 + +Y +DM+YA++KLDDT+F++ + YIRV Sbjct: 149 MVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRV 182
>SFRS1_BRARE (Q6NYA0) Splicing factor, arginine/serine-rich 1| Length = 245 Score = 33.1 bits (74), Expect = 0.58 Identities = 14/35 (40%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSK-GYIRVK 469 + ++ +DM YA++KLD+T+F++ + YIRVK Sbjct: 158 VVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVK 192
>SF1L1_BRARE (Q7SXP4) Splicing factor, arginine/serine-rich 1-like protein 1| Length = 245 Score = 33.1 bits (74), Expect = 0.58 Identities = 14/35 (40%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSK-GYIRVK 469 + ++ +DM YA++KLD+T+F++ + YIRVK Sbjct: 169 VVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVK 203
>SFRS1_CHICK (Q5ZML3) Splicing factor, arginine/serine-rich 1| Length = 256 Score = 33.1 bits (74), Expect = 0.58 Identities = 14/35 (40%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSK-GYIRVK 469 + ++ +DM YA++KLD+T+F++ + YIRVK Sbjct: 158 VVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVK 192
>SFRS1_XENTR (Q6DII2) Splicing factor, arginine/serine-rich 1| Length = 267 Score = 33.1 bits (74), Expect = 0.58 Identities = 14/35 (40%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSK-GYIRVK 469 + ++ +DM YA++KLD+T+F++ + YIRVK Sbjct: 178 VVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVK 212
>SFRS1_PONPY (Q5R7H2) Splicing factor, arginine/serine-rich 1| Length = 247 Score = 33.1 bits (74), Expect = 0.58 Identities = 14/35 (40%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSK-GYIRVK 469 + ++ +DM YA++KLD+T+F++ + YIRVK Sbjct: 158 VVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVK 192
>SFRS1_MOUSE (Q6PDM2) Splicing factor, arginine/serine-rich 1| Length = 247 Score = 33.1 bits (74), Expect = 0.58 Identities = 14/35 (40%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSK-GYIRVK 469 + ++ +DM YA++KLD+T+F++ + YIRVK Sbjct: 158 VVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVK 192
>SFRS1_HUMAN (Q07955) Splicing factor, arginine/serine-rich 1 (pre-mRNA-splicing| factor SF2, P33 subunit) (Alternative splicing factor ASF-1) Length = 247 Score = 33.1 bits (74), Expect = 0.58 Identities = 14/35 (40%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSK-GYIRVK 469 + ++ +DM YA++KLD+T+F++ + YIRVK Sbjct: 158 VVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVK 192
>PUS5_KLULA (Q6CQC4) Pseudouridylate synthase PUS5 (EC 5.4.99.-) (Pseudouridine| synthase 5) (Uracil hydrolyase PUS5) Length = 299 Score = 32.0 bits (71), Expect = 1.3 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -3 Query: 570 IADYTNYDDMKYAIKKLDDTEFKNAFSKGYIRVK 469 + D Y+D+KY KK+ D++F+ A YIR K Sbjct: 197 VLDSPIYNDLKYGGKKVFDSDFQIALHSAYIRTK 230 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,179,831 Number of Sequences: 219361 Number of extensions: 1108415 Number of successful extensions: 2848 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2848 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
