| Clone Name | rbasd21d14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CAN10_RAT (Q9ES66) Calpain-10 (EC 3.4.22.-) (Calcium-activated n... | 32 | 1.4 | 2 | CAN10_MOUSE (Q9ESK3) Calpain-10 (EC 3.4.22.-) (Calcium-activated... | 32 | 1.4 | 3 | FILA_MOUSE (P11088) Filaggrin (Fragment) | 29 | 8.9 |
|---|
>CAN10_RAT (Q9ES66) Calpain-10 (EC 3.4.22.-) (Calcium-activated neutral| proteinase 10) (CANP 10) Length = 666 Score = 32.0 bits (71), Expect = 1.4 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 7/64 (10%) Frame = -3 Query: 395 FPRRPWEG-----LLCICWNRMESFPRRRGATRIDVV--PGKMAWQDHVGEAMFSCCAIR 237 FP PWEG LL CW ++ +D V PG+ W D + F+C + Sbjct: 56 FPDNPWEGQVKQGLLGDCWFLCACAALQKSRHLLDQVFPPGQPGWSDQEYQGFFTCRIWQ 115 Query: 236 IKHF 225 H+ Sbjct: 116 FGHW 119
>CAN10_MOUSE (Q9ESK3) Calpain-10 (EC 3.4.22.-) (Calcium-activated neutral| proteinase 10) (CANP 10) Length = 666 Score = 32.0 bits (71), Expect = 1.4 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 7/64 (10%) Frame = -3 Query: 395 FPRRPWEG-----LLCICWNRMESFPRRRGATRIDVV--PGKMAWQDHVGEAMFSCCAIR 237 FP PWEG LL CW ++ +D V PG+ W D + F+C + Sbjct: 56 FPDNPWEGQVKQGLLGDCWFLCACAALQKSQHLLDQVFPPGQPGWSDQKYQGFFTCRIWQ 115 Query: 236 IKHF 225 H+ Sbjct: 116 FGHW 119
>FILA_MOUSE (P11088) Filaggrin (Fragment)| Length = 336 Score = 29.3 bits (64), Expect = 8.9 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 486 EQPEPGHGDQQLCRRGHDGS 427 EQPE GH QQ RGH G+ Sbjct: 189 EQPESGHRQQQSSGRGHQGA 208 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,198,342 Number of Sequences: 219361 Number of extensions: 1764326 Number of successful extensions: 3992 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3992 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)