| Clone Name | rbasd20m14 |
|---|---|
| Clone Library Name | barley_pub |
>PKHD1_HUMAN (Q8TCZ9) Polycystic kidney and hepatic disease 1 precursor| (Fibrocystin) (Polyductin) (Tigmin) Length = 4074 Score = 32.7 bits (73), Expect = 0.23 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 189 TDVPRLCNVNVKCRERKFFSFPFFLLPGESHGC 91 TD+P ++ ++C R SFPF PG++ GC Sbjct: 2656 TDLPPYPDILLRCGSRVGLSFPFLPSPGQNQGC 2688
>YJP2_YEAST (P47003) Hypothetical 13.7 kDa protein in INO1-IDS2 intergenic| region Length = 119 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = +2 Query: 17 HRAXKHIQMHKREIPAQTTKHLHYVHPCDSPGRRKKGKEKNFLSLHFTFTL 169 H HI IP T +H H H D +R + K N L + F T+ Sbjct: 9 HTWPPHISHSTLSIPHPTPEHRHVFHKKDVKNKRNEEKGNNLLYVLFRTTV 59
>POL2_BRAV (Q9YK98) RNA2 polyprotein (P2) [Contains: P2A protein; Movement| protein (MP); Coat protein (CP)] Length = 1626 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 113 RRKKGKEKNFLSLHFTFTLQRRGTSVEPEPAXSVCGWRPFFXA 241 +RKK K+K F S F +R+ P P V W + A Sbjct: 594 KRKKNKKKEFHSFSACFAFKRKQIQWPPTPNEMVNEWEEYCIA 636
>KR10C_HUMAN (P60413) Keratin-associated protein 10-12 (Keratin-associated| protein 10.12) (High sulfur keratin-associated protein 10.12) (Keratin-associated protein 18-12) (Keratin-associated protein 18.12) Length = 245 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 78 CLVVCAGISLLCI*MCXXARCVPSC 4 C+ VC+G S LC C + C P+C Sbjct: 162 CVPVCSGASSLC---CQQSSCQPAC 183
>KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-associated| protein 10.8) (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8) Length = 259 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 78 CLVVCAGISLLCI*MCXXARCVPSC 4 C+ VC+G S LC C + C P+C Sbjct: 176 CVPVCSGASSLC---CQKSSCQPAC 197
>KORB2_ECOLI (P07674) Transcriptional repressor protein korB| Length = 358 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 249 RWFAXKKGRQPHTLXAGSGSTDVPR 175 R F +KGR P+T+ A +G TD R Sbjct: 247 REFLDEKGRDPNTVDAFNGQTDAER 271 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,325,826 Number of Sequences: 219361 Number of extensions: 804590 Number of successful extensions: 2185 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2185 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)