| Clone Name | rbasd20m07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRMU_CORGL (Q8NR24) Probable tRNA (5-methylaminomethyl-2-thiouri... | 33 | 0.64 | 2 | TRMU_COREF (Q8FQ01) Probable tRNA (5-methylaminomethyl-2-thiouri... | 31 | 4.2 | 3 | MPAA2_AMBAR (P27762) Pollen allergen Amb a 2 precursor (Antigen ... | 31 | 4.2 | 4 | UBP2_CHICK (O57429) Ubiquitin carboxyl-terminal hydrolase 2 (EC ... | 30 | 7.1 |
|---|
>TRMU_CORGL (Q8NR24) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 365 Score = 33.5 bits (75), Expect = 0.64 Identities = 21/60 (35%), Positives = 31/60 (51%) Frame = -3 Query: 682 LGFLLNGDDRSEECEIWLKAHGAVLSVDNSGELQIDTKASSSMLFMPEPENAVAHGDASL 503 L FL D +CE+ ++AHG V+S + ID A +L + EP VA G A++ Sbjct: 288 LKFLHPAMDGQIDCEVQVRAHGGVVSCSAT----IDRDADFMVLNLNEPLQGVARGQAAV 343
>TRMU_COREF (Q8FQ01) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 365 Score = 30.8 bits (68), Expect = 4.2 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -3 Query: 700 GMLHRF-LGFLLNGDDRSEECEIWLKAHGAVLSVDNSGELQIDTKASSSMLFMPEPENAV 524 G++H L FL D +CE+ ++AHG V+ +ID A + L + E + V Sbjct: 281 GVIHADRLKFLHPAMDGELDCEVQVRAHGGVVKC----HARIDRTADTMRLDLAESLSGV 336 Query: 523 AHGDASL 503 A G A++ Sbjct: 337 ARGQAAV 343
>MPAA2_AMBAR (P27762) Pollen allergen Amb a 2 precursor (Antigen K) (Antigen Amb| a II) Length = 397 Score = 30.8 bits (68), Expect = 4.2 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = -1 Query: 600 ITVENCR*TQR---LLLVCFSCRSQRMRLHMAMRHLQLTTSLHVRRRRCTYG 454 +T+ NC+ T +LL Q +++H+ + + T ++H R RC +G Sbjct: 230 VTISNCKFTHHEKAVLLGASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFG 281
>UBP2_CHICK (O57429) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 357 Score = 30.0 bits (66), Expect = 7.1 Identities = 22/64 (34%), Positives = 27/64 (42%), Gaps = 12/64 (18%) Frame = +3 Query: 378 E*QRILIRAGANACIHMHQHADELHRHTYTFYDVRA------------KKSLTASDASPC 521 E R+L+R ANA H DE R + Y R K SLT S+ C Sbjct: 124 EVNRVLVRPRANADTLDHLPDDEKSRQMWRRYQEREDSRVSDLFVGQLKSSLTCSECGYC 183 Query: 522 ATAF 533 +TAF Sbjct: 184 STAF 187 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 110,087,320 Number of Sequences: 219361 Number of extensions: 2475272 Number of successful extensions: 5721 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5717 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7026286028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)