| Clone Name | rbasd20k01 |
|---|---|
| Clone Library Name | barley_pub |
>ORK1_DROME (Q94526) Open rectifier potassium channel protein 1 (Two pore| domain potassium channel Ork1) Length = 1001 Score = 32.3 bits (72), Expect = 1.4 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 585 RTPPAPYEKSKSLGSGGSMVARLKLKGIDGRAPP 484 R PP P+E + SL SGG + + + DG PP Sbjct: 599 RGPPPPFESNGSLASGGGGLTNMGFQMEDGATPP 632
>APE1_AERPE (O73942) Homing endonuclease I-ApeI (EC 3.1.-.-) (rRNA| intron-encoded homing endonuclease 1) Length = 222 Score = 32.0 bits (71), Expect = 1.9 Identities = 19/34 (55%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -2 Query: 561 KSKSLGS--GGSMVARLKLKGIDGRAPPGVEPAA 466 KSK L G + KLKGI G AP GVEPAA Sbjct: 189 KSKKLNELLGRPLPGPSKLKGIGGGAPQGVEPAA 222
>STAT1_HUMAN (P42224) Signal transducer and activator of transcription| 1-alpha/beta (Transcription factor ISGF-3 components p91/p84) Length = 750 Score = 31.6 bits (70), Expect = 2.4 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +1 Query: 127 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 234 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>STAT1_PIG (Q764M5) Signal transducer and activator of transcription 1| Length = 757 Score = 31.6 bits (70), Expect = 2.4 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +1 Query: 127 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 234 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>DPOLZ_MOUSE (Q61493) DNA polymerase zeta catalytic subunit (EC 2.7.7.7)| (Seizure-related protein 4) Length = 3122 Score = 30.0 bits (66), Expect = 7.1 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +3 Query: 339 QTNRSTN*ERPCTTTHRIKKELSVCQSLLCLDLVSFPVLSQIKPQAPRLVVPFRQ 503 Q +STN + T+TH+ K +SV + + PV S KP+ PR P Q Sbjct: 1537 QKAQSTNVVQDSTSTHQPDKNISVSNEHKKANKRTRPVTSPRKPRTPRRTKPKEQ 1591
>MPD2_YEAST (Q99316) Protein disulfide isomerase MPD2 precursor (EC 5.3.4.1)| Length = 277 Score = 29.6 bits (65), Expect = 9.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 423 LCLDLVSFPVLSQIKPQAPRLVVP 494 LC DL FP++ +KP+ LV+P Sbjct: 98 LCTDLPGFPIIELVKPRTKPLVLP 121
>ERF_HUMAN (P50548) ETS domain-containing transcription factor ERF (Ets2| repressor factor) Length = 548 Score = 29.6 bits (65), Expect = 9.3 Identities = 27/88 (30%), Positives = 36/88 (40%), Gaps = 13/88 (14%) Frame = -2 Query: 657 EDDQDTVLVSTINDADQGSADV--AYRTPPAPYEKSKSLGSGGSMVARLKLK-----GID 499 E + + V V+ I+D D+ +V R PPAP + G S LKL+ D Sbjct: 432 EGESEEVEVTDISDEDEEDGEVFKTPRAPPAPPKPEPGEAPGASQCMPLKLRFKRRWSED 491 Query: 498 GRAPPGVEPAA*FD------STRGNLPG 433 R G PA F+ RG PG Sbjct: 492 CRLEGGGGPAGGFEDEGEDKKVRGEGPG 519
>TEGU_SHV21 (Q01056) Probable large tegument protein| Length = 2469 Score = 29.6 bits (65), Expect = 9.3 Identities = 17/54 (31%), Positives = 24/54 (44%) Frame = +3 Query: 447 PVLSQIKPQAPRLVVPFRQFL*VSALRPYSPRNPKTLISHKVPAESYKQHPPIP 608 P +Q P+ PR P + P +PR PKT +P + K+ P IP Sbjct: 253 PTSTQKPPKTPRTPKP------ATPKAPKTPRKPKTPKESTIPYDKSKKPPKIP 300 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,688,085 Number of Sequences: 219361 Number of extensions: 2303746 Number of successful extensions: 4924 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4919 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7026286028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)