| Clone Name | rbasd20d23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LHX8_MOUSE (O35652) LIM/homeobox protein Lhx8 (LIM homeodomain L... | 33 | 1.4 | 2 | VCLA_GOSHI (P09799) Vicilin GC72-A precursor (Alpha-globulin A) | 32 | 2.3 | 3 | MST2_DROHY (Q08696) Axoneme-associated protein mst101(2) | 32 | 3.1 | 4 | ADA19_HUMAN (Q9H013) ADAM 19 precursor (EC 3.4.24.-) (A disinteg... | 30 | 6.8 |
|---|
>LHX8_MOUSE (O35652) LIM/homeobox protein Lhx8 (LIM homeodomain Lhx7) (L3)| Length = 367 Score = 32.7 bits (73), Expect = 1.4 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = +1 Query: 115 SSCGKHT*QTNLLKEGKGTEFHGALF*ERHRQSCCYCKLLVFYSHAFAVIASKTYTRAY 291 S CG+H T+ ++ KG +H A F +C CK + FA++ K R + Sbjct: 158 SRCGRHIHSTDWVRRAKGNVYHLACF------ACFSCKRQLSTGEEFALVEEKVLCRVH 210
>VCLA_GOSHI (P09799) Vicilin GC72-A precursor (Alpha-globulin A)| Length = 605 Score = 32.0 bits (71), Expect = 2.3 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -3 Query: 636 CDHKCQ-HHKVPAXKKQCVDECHRRKHHHPSRAACERKCSHWRDPTRKE 493 C +CQ + P K+QCV EC + P + E K WR+ +E Sbjct: 125 CQQRCQWQEQRPERKQQCVKECREQYQEDPWKGERENK---WREEEEEE 170 Score = 31.2 bits (69), Expect = 4.0 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 7/66 (10%) Frame = -3 Query: 651 RATTSCDHKCQHHKV---PAXKKQCVDECHRRKHHHPSRA--ACERKCSHWRD--PTRKE 493 R C CQ + P ++ C ++ +++ P + C+++C W++ P RK+ Sbjct: 82 RRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDKQFKECQQRCQ-WQEQRPERKQ 140 Query: 492 RCVQTC 475 +CV+ C Sbjct: 141 QCVKEC 146
>MST2_DROHY (Q08696) Axoneme-associated protein mst101(2)| Length = 1391 Score = 31.6 bits (70), Expect = 3.1 Identities = 14/56 (25%), Positives = 25/56 (44%) Frame = -3 Query: 636 CDHKCQHHKVPAXKKQCVDECHRRKHHHPSRAACERKCSHWRDPTRKERCVQTCMR 469 C+ + + K A KKQC + + K + CE + ++ K+RC + R Sbjct: 1080 CEERAKKEKEAAEKKQCEERAKKLKEA-AEKKQCEERAKKEKEAAEKKRCEEAAKR 1134
>ADA19_HUMAN (Q9H013) ADAM 19 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 19) (Meltrin beta) (Metalloprotease and disintegrin dentritic antigen marker) (MADDAM) Length = 956 Score = 30.4 bits (67), Expect = 6.8 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 158 KEKEQSSMELSSRRGIANHAATASYWSFILTPLPS*LARRIRGRIYRSVYTR 313 +E E SS+ LS+ RGI +S S+++ PLP + + IYRS + + Sbjct: 121 RETELSSVTLSTCRGIRGLITVSSNLSYVIEPLPDSKGQHL---IYRSEHLK 169 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,596,685 Number of Sequences: 219361 Number of extensions: 1384879 Number of successful extensions: 3313 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3304 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 8805300816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)