| Clone Name | rbasd20a07 |
|---|---|
| Clone Library Name | barley_pub |
>PURL_LEPIN (Q8F6I3) Phosphoribosylformylglycinamidine synthase II (EC 6.3.5.3)| (FGAM synthase II) Length = 745 Score = 30.0 bits (66), Expect = 3.4 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = -1 Query: 461 STKTSLRSLKLDDFVQAKAKVSPSVAFDATSMNELRKWNEQYG 333 S TSLR +LD + ++ + V FD+ S ++RK E YG Sbjct: 660 SDLTSLRRNRLDLTLFGESSTAVLVGFDSLSKEDIRKQTEAYG 702
>PURL_LEPIC (Q72PR5) Phosphoribosylformylglycinamidine synthase II (EC 6.3.5.3)| (FGAM synthase II) Length = 745 Score = 30.0 bits (66), Expect = 3.4 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = -1 Query: 461 STKTSLRSLKLDDFVQAKAKVSPSVAFDATSMNELRKWNEQYG 333 S TSLR +LD + ++ + V FD+ S ++RK E YG Sbjct: 660 SDLTSLRRNRLDLTLFGESSTAVLVGFDSLSKEDIRKQTEAYG 702
>CYSA_SHIFL (Q7UC29) Sulfate/thiosulfate import ATP-binding protein cysA (EC| 3.6.3.25) (Sulfate-transporting ATPase) Length = 365 Score = 29.6 bits (65), Expect = 4.4 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = -2 Query: 190 YGGPVSIGRRLTNTEVS*ATATGSPVSNVVLLSCPSGGLTXLYIGTTILYQEQPTV 23 Y GPV + R ++S T+ SP+ VL + P G T L + Y E TV Sbjct: 267 YQGPVDLFLRPWEVDISRRTSLDSPLPVQVLEASPKGHYTQLVVQPLGWYNEPLTV 322
>CYSA_ECOLI (P16676) Sulfate/thiosulfate import ATP-binding protein cysA (EC| 3.6.3.25) (Sulfate-transporting ATPase) Length = 365 Score = 29.6 bits (65), Expect = 4.4 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = -2 Query: 190 YGGPVSIGRRLTNTEVS*ATATGSPVSNVVLLSCPSGGLTXLYIGTTILYQEQPTV 23 Y GPV + R ++S T+ SP+ VL + P G T L + Y E TV Sbjct: 267 YQGPVDLFLRPWEVDISRRTSLDSPLPVQVLEASPKGHYTQLVVQPLGWYNEPLTV 322
>CYSA_ECOL6 (Q8FFB3) Sulfate/thiosulfate import ATP-binding protein cysA (EC| 3.6.3.25) (Sulfate-transporting ATPase) Length = 365 Score = 29.6 bits (65), Expect = 4.4 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = -2 Query: 190 YGGPVSIGRRLTNTEVS*ATATGSPVSNVVLLSCPSGGLTXLYIGTTILYQEQPTV 23 Y GPV + R ++S T+ SP+ VL + P G T L + Y E TV Sbjct: 267 YQGPVDLFLRPWEVDISRRTSLDSPLPVQVLEASPKGHYTQLVVQPLGWYNEPLTV 322
>CYSA_ECO57 (Q8XBJ8) Sulfate/thiosulfate import ATP-binding protein cysA (EC| 3.6.3.25) (Sulfate-transporting ATPase) Length = 365 Score = 29.6 bits (65), Expect = 4.4 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = -2 Query: 190 YGGPVSIGRRLTNTEVS*ATATGSPVSNVVLLSCPSGGLTXLYIGTTILYQEQPTV 23 Y GPV + R ++S T+ SP+ VL + P G T L + Y E TV Sbjct: 267 YQGPVDLFLRPWEVDISRRTSLDSPLPVQVLEASPKGHYTQLVVQPLGWYNEPLTV 322
>RYR1_PIG (P16960) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5035 Score = 29.6 bits (65), Expect = 4.4 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -1 Query: 416 QAKAKVSPSVAFDATSMNELRKWNEQYGEGGSRSKSPFG 300 +A A++SPS+ +A LR E +GG ++ P G Sbjct: 1794 EAPARLSPSIPLEALRDKALRMLGEAVRDGGQHARDPVG 1832
>UBP47_HUMAN (Q96K76) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1375 Score = 29.3 bits (64), Expect = 5.8 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -3 Query: 249 GHSAPSSGFWYSPRASSSGAMVALYR*ADA*RTPKFXE 136 G S+ S G++ S ASS+ A + +YR D R KF E Sbjct: 537 GGSSGSRGYYSSAFASSTNAYMLIYRLKDPARNAKFLE 574
>UBP47_MOUSE (Q8BY87) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1376 Score = 29.3 bits (64), Expect = 5.8 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -3 Query: 249 GHSAPSSGFWYSPRASSSGAMVALYR*ADA*RTPKFXE 136 G S+ S G++ S ASS+ A + +YR D R KF E Sbjct: 537 GGSSGSRGYYSSAFASSTNAYMLIYRLKDPTRNAKFLE 574
>VG37_BPT4 (P03744) Long tail fiber protein p37 (Protein Gp37) (Receptor| recognizing protein) Length = 1026 Score = 28.9 bits (63), Expect = 7.6 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -1 Query: 422 FVQAKAKVSPSVAFDATSMNELRKWNEQYGEGGSRSKSPF 303 FVQ + ++ V T+ N LR WN +YG RS+S F Sbjct: 566 FVQGGSSITGQVKIGGTA-NALRIWNAEYGAIFRRSESNF 604
>GLB5_OLIMA (Q7M413) Hemoglobin, extracellular, major globin chain a5| Length = 142 Score = 28.9 bits (63), Expect = 7.6 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 3/24 (12%) Frame = -1 Query: 380 DATSMNEL---RKWNEQYGEGGSR 318 D TS+N L R+W E YGEG SR Sbjct: 1 DCTSLNRLLVKRQWAEAYGEGTSR 24
>FOXGB_MOUSE (Q60987) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) Length = 481 Score = 28.5 bits (62), Expect = 9.9 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -2 Query: 169 GRRLTNTEVS*ATATGS---PVSNVVLLSCPSGGLTXLYIGTTILYQEQPTVY 20 G RLT+T ++ GS P+S + L P T Y GTT Y P Y Sbjct: 281 GARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPY 333
>RYR1_HUMAN (P21817) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5038 Score = 28.5 bits (62), Expect = 9.9 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -1 Query: 416 QAKAKVSPSVAFDATSMNELRKWNEQYGEGGSRSKSPFG 300 +A A++SP++ +A LR E +GG ++ P G Sbjct: 1793 EAPARLSPAIPLEALRDKALRMLGEAVRDGGQHARDPVG 1831
>RYR1_RABIT (P11716) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5037 Score = 28.5 bits (62), Expect = 9.9 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -1 Query: 416 QAKAKVSPSVAFDATSMNELRKWNEQYGEGGSRSKSPFG 300 +A A++SP++ +A LR E +GG ++ P G Sbjct: 1793 EAPARLSPAIPLEALRDKALRMLGEAVRDGGQHARDPVG 1831
>FOXGB_RAT (Q00939) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) Length = 480 Score = 28.5 bits (62), Expect = 9.9 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -2 Query: 169 GRRLTNTEVS*ATATGS---PVSNVVLLSCPSGGLTXLYIGTTILYQEQPTVY 20 G RLT+T ++ GS P+S + L P T Y GTT Y P Y Sbjct: 280 GARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPY 332 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,572,506 Number of Sequences: 219361 Number of extensions: 1097749 Number of successful extensions: 2834 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2834 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)