| Clone Name | rbasd19e16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GUC2E_RAT (P51840) Guanylyl cyclase GC-E precursor (EC 4.6.1.2) ... | 29 | 3.2 | 2 | GUC2E_MOUSE (P52785) Guanylyl cyclase GC-E precursor (EC 4.6.1.2... | 29 | 3.2 | 3 | OAZ3_MOUSE (Q9R109) Ornithine decarboxylase antizyme 3 (ODC-Az 3... | 28 | 4.2 | 4 | LAMB2_MOUSE (Q61292) Laminin beta-2 chain precursor (S-laminin) ... | 27 | 9.4 |
|---|
>GUC2E_RAT (P51840) Guanylyl cyclase GC-E precursor (EC 4.6.1.2) (Guanylate| cyclase 2E) Length = 1108 Score = 28.9 bits (63), Expect = 3.2 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = +3 Query: 84 MSNPCMGQVNLPSSXVQSSQKAITLRPGPTIICKMIPCSALAQKE--ALVHPFCPGDACS 257 + PC+ +L V S+ ++ GP P LAQ+ ALV CPG + Sbjct: 104 LPEPCLTPGSL--GAVSSALTRVSGLVGPVNPAACRPAELLAQEAGVALVPWGCPGTRAA 161 Query: 258 GATMPAV 278 G T PAV Sbjct: 162 GTTAPAV 168
>GUC2E_MOUSE (P52785) Guanylyl cyclase GC-E precursor (EC 4.6.1.2) (Guanylate| cyclase 2E) Length = 1108 Score = 28.9 bits (63), Expect = 3.2 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = +3 Query: 84 MSNPCMGQVNLPSSXVQSSQKAITLRPGPTIICKMIPCSALAQKE--ALVHPFCPGDACS 257 + PC+ +L V S+ ++ GP P LAQ+ ALV CPG + Sbjct: 104 LPEPCLTPGSL--GAVSSALSRVSGLVGPVNPAGCRPAELLAQEAGVALVPWGCPGTRAA 161 Query: 258 GATMPAV 278 G T PAV Sbjct: 162 GTTAPAV 168
>OAZ3_MOUSE (Q9R109) Ornithine decarboxylase antizyme 3 (ODC-Az 3) (AZ3)| (OAZ-t) Length = 195 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 123 SXVQSSQKAITLRPGPTIICKMIPCSALAQKEAL 224 S Q+ +TLRP + C +PCS L E+L Sbjct: 8 SITYKEQEDLTLRPHCCLPCSCLPCSCLQCSESL 41
>LAMB2_MOUSE (Q61292) Laminin beta-2 chain precursor (S-laminin) (S-LAM)| Length = 1799 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 180 CKMIPCSALAQKEALVHPFCPGDACSGATMPA 275 C PC ++ P C G CSGA PA Sbjct: 1419 CATSPCGGAGCRDEDGQPRCGGLGCSGAAAPA 1450 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,747,655 Number of Sequences: 219361 Number of extensions: 975323 Number of successful extensions: 2018 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1983 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2018 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)