ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd19e11 |
|---|---|
| Clone Library Name | barley_pub |
>RBL_AEGTA (P25414) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 421 Score = 74.3 bits (181), Expect = 8e-14 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDRA G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 296 DDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 335
>RBL_AEGCR (P25413) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 421 Score = 74.3 bits (181), Expect = 8e-14 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDRA G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 296 DDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 335
>RBL_BAMGL (P51994) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 440 Score = 74.3 bits (181), Expect = 8e-14 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDRA G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 340 DDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 379
>RBL_HORVU (P05698) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 426 Score = 74.3 bits (181), Expect = 8e-14 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDRA G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_WHEAT (P11383) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 74.3 bits (181), Expect = 8e-14 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDRA G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_ORYSA (P12089) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 74.3 bits (181), Expect = 8e-14 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDRA G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_ORYNI (Q6ENG6) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 74.3 bits (181), Expect = 8e-14 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDRA G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_AVESA (P48684) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 74.3 bits (181), Expect = 8e-14 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDRA G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_ABIMR (O78261) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 344 DDFIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPAL 383
>RBL_ANACO (P48683) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 479 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_NEUTE (P19164) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 478 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGVFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_NEUMU (P19163) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 478 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGVFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_CAMLE (Q95694) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 447 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 381
>RBL_SERRE (P25836) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_PHORE (P28262) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_CALUS (P25829) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_SACOF (Q6ENV5) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 476 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_SACHY (Q6L391) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 476 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_MAIZE (P00874) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 476 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_DRYSU (P28259) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 471 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_BARSC (Q33162) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 456 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 344 DDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 383
>RBL_STRLC (Q36800) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_NYPFR (P28261) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 380
>RBL_LIRPL (P93913) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 449 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 344 DDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 383
>RBL_HYOLA (Q9BA49) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_ABIMA (P24671) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 73.2 bits (178), Expect = 2e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_ASPEL (P92445) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 449 Score = 72.4 bits (176), Expect = 3e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 344 DDFIEKDRRRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 383
>RBL_IRIGE (Q37227) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 340 DDYIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPAL 379
>RBL_ABIVE (O78260) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 344 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 383
>RBL_ABISA (O78262) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 344 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 383
>RBL_ABIHO (O78259) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 344 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 383
>RBL_ABIFI (O78258) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 344 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 383
>RBL_CUNLA (Q32026) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 460 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 380
>RBL_CRYJA (P48696) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 460 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 380
>RBL_VICCZ (Q05803) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_NYMOD (Q05802) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_NUPVA (Q05801) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_EURFE (Q05799) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_CERDE (Q05798) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_CABCA (Q05797) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_BRASC (Q05796) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_BARLO (Q05795) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_ALIPL (P34767) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDYIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_WELMI (P48719) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 444 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVMPVASGGIHVWHMPAL 381
>RBL_WATAN (P93936) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 444 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 344 DDYIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPAL 383
>RBL_GINBI (P48704) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 444 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGDIHVWHMPAL 381
>RBL_EPHTW (Q32223) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 380
>RBL_EPHSI (Q37328) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 444 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_COROL (Q32041) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGLFFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_COROF (Q32042) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGLFFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_GLAGU (P93906) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 458 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 344 DDYIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPAL 383
>RBL_AMOTI (Q8MD78) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 473 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 345 DDYIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 384
>RBL_TASIN (P28456) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_CEDAT (Q9GGX6) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 343 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 382
>RBL_SALPE (P31201) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 452 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDYIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_PINVI (Q8WKC9) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 418 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 326 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 365
>RBL_ZAMZA (O98681) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 449 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDYIEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPAL 381
>RBL_PERAE (P30830) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_CORAT (Q31948) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVS+PGV PVASG IHVWHMPAL Sbjct: 344 DDFIEKDRSRGLFFTQDWVSLPGVLPVASGGIHVWHMPAL 383
>RBL_MEDSA (P04991) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 474 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_PSEMZ (P69571) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_PSEKA (P24681) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_PODGR (P24680) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVIPVASGGIHVWHMPAL 390
>RBL_PINWA (P24676) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGVYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_PINTH (P41621) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_PINRA (P24679) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_PINPI (P24678) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVMPVASGGIHVWHMPAL 390
>RBL_PINLO (P24677) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_PINKR (P26963) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVMPVASGGIHVWHMPAL 390
>RBL_PINKO (Q7GUD0) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGVYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_PINED (P24675) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVMPVASGGIHVWHMPAL 390
>RBL_PINBA (P26962) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_PICSI (P26961) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_PICPU (P24674) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_PICAB (P48711) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_NYMAL (Q6EW71) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_LAROX (P69570) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_KETDA (P26960) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_EQUAR (P48702) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_CEDDE (P26959) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_CALFE (Q7YJW4) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_AMBTC (Q70XZ5) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_TROMA (P48717) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_THEPO (P28457) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_SAUCE (P36486) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_ISOTA (P92463) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDYIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_IRIEN (P92306) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 469 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDYIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_AKABI (Q07281) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 469 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q WVS+PGV PVASG IHVWHMPAL Sbjct: 345 DDFIEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPAL 384
>RBL_ARIGL (P93890) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 451 Score = 72.0 bits (175), Expect = 4e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G FF Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDYIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_SETIT (P56647) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 476 Score = 71.6 bits (174), Expect = 5e-13 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G FF Q W SMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIFFTQDWASMPGVIPVASGGIHVWHMPAL 390
>RBL_PRUDO (P28445) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 71.6 bits (174), Expect = 5e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 341 DDFVEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 380
>RBL_MORAL (P28431) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 71.6 bits (174), Expect = 5e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 341 DDFVEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 380
>RBL_OXADI (P28436) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 71.6 bits (174), Expect = 5e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G FF Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_MOROL (P48708) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 71.6 bits (174), Expect = 5e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G FF Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_DIOMU (P28401) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 71.6 bits (174), Expect = 5e-13 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDRA G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRARGIYFTQFWVSIPGVLPVASGGIHVWHMPAL 381
>RBL_GOSHI (P14958) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 71.2 bits (173), Expect = 7e-13 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRRRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_BUDDA (P36482) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 317 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 356
>RBL_TAMIN (P93869) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_SEDRU (P28455) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 450 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_NELLU (Q05800) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 394 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_CRAMA (P28395) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 450 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_CASDI (P93880) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_BROCO (P93988) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_PLAVR (P28442) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_OSMCI (P33536) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 444 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDYIEKDRSRGIYFTQDWVSMPGVFPVASGGIHVWHMPAL 381
>RBL_MYRCE (P28432) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_MORRU (Q32625) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_IDEPO (Q9XPR5) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_HUMBA (P28424) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 380
>RBL_HAMMO (P28419) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_FRAAN (P48703) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_CASFS (O20304) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_BYRCR (P28387) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 380
>RBL_BOTST (P36477) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 444 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_BAURU (Q31730) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 380
>RBL_AILAL (Q07209) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_ACTCH (P28377) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDRA G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDYIEKDRARGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_ACESA (P28376) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_SINAL (P48715) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 473 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_PANGI (Q68RZ8) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 478 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_MONDI (Q33619) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 473 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 390
>RBL_EXAAF (Q05989) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 446 Score = 70.9 bits (172), Expect = 9e-13 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 317 DDFIEKDRSXGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 356
>RBL_LIGVU (Q05991) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 447 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 317 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 356
>RBL_SCUBO (P28453) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 381
>RBL_JASSU (P28427) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_HYDVI (P28425) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 467 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G FF Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDYIEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_GLEJA (P48705) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 410 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 328 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 367
>RBL_STRNX (P36489) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 471 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 381
>RBL_LIRTU (P30827) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 476 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFSQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_EUCLU (P28414) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 448 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_DICCR (P31184) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 448 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 350 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 389
>RBL_ANEME (Q31674) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 420 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 331 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 370
>RBL_SAXIN (P28452) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_RORGO (P28448) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDRA G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDYIEKDRARGIYFSQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_PARFI (P28437) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_NYSOG (P28435) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_HEUMI (P28423) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_GEUCH (P28418) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_GAREL (P28416) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_CORLA (P31183) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_CERGU (P28391) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_APIGR (P28380) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 459 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_SALPL (P31202) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 449 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_HIPRI (P31189) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 449 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_PTEVI (Q33015) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 440 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 341 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 380
>RBL_POLMU (P48712) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 440 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 341 DDYIEKDRSRGIYFTQDWVSMPGVHPVASGGIHVWHMPAL 380
>RBL_ONOSE (P48710) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 440 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 341 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 380
>RBL_MATST (P48707) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 440 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 341 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 380
>RBL_DICAN (P48701) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 440 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 341 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 380
>RBL_ONYJA (Q36610) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 414 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 329 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 368
>RBL_ANTRE (P43224) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 414 Score = 70.9 bits (172), Expect = 9e-13 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 330 DDFIEKDRNRGIYFTQDWVSMPGVIPVASGGIHVWHMPAL 369
>RBL_LATCL (Q33584) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 390
>RBL_LACSA (P48706) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_GERJA (P51101) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_DIGPU (P28399) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 390
>RBL_CICIN (P48693) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_CARTI (P48689) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 477 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_ADIPE (P43223) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 413 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 328 DDYIEKDRSRGIYFTQDWVSMPGVFPVASGGIHVWHMPAL 367
>RBL_CHEBI (P43227) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 416 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 328 DDYIEKDRSRGIYFTQDWVSMPGVFPVASGGIHVWHMPAL 367
>RBL_ARTBA (P43225) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 416 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 330 DDYIEKDRSRGVYFTQDWVSMPGVIPVASGGIHVWHMPAL 369
>RBL_ACRAU (P43222) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 417 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 331 DDYIEKDRSRGIYFTQDWVSMPGVIPVASGGIHVWHMPAL 370
>RBL_TECST (O98671) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 381
>RBL_PANJS (O98668) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 380
>RBL_CIBBA (P43228) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 415 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 329 DDYIEKDRSRGVYFTQDWVSMPGVLPVASGGIHVWHMPAL 368
>RBL_CATSP (Q33383) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 381
>RBL_ANTHE (Q31669) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 468 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDRA G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDYIEKDRARGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_POLRE (Q05992) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 317 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 356
>RBL_PELRO (Q32890) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFI+KDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDFIQKDRSRGIYFTQDWVSMPGVFPVASGGIHVWHMPAL 381
>RBL_PELAN (Q32770) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDYIEKDRSRGIYFTQDWVSMPGVFPVASGGIHVWHMPAL 381
>RBL_NOTFE (Q32668) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDYIEKDRSRGIYFTQDWVSMPGVFPVASGGIHVWHMPAL 381
>RBL_NOTDE (Q32663) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 381
>RBL_DARCA (P28398) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDRA G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDYIEKDRARGIYFSQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_CHELA (Q32016) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 441 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 342 DDYIEKDRSRGIYFTQDWVSMPGVFPVASGGIHVWHMPAL 381
>RBL_VISAL (P48718) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_SPIMX (P48716) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_PSINU (P48714) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDYIEKDRSRGVYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_OENHO (Q9MTP9) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_NOTSU (Q32701) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_MAGTR (P61293) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_MAGMA (P30829) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_MAGAC (P30732) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_LIQST (Q01873) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_HUPLU (Q5SCV9) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_COLOB (P48695) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_CLAXA (P28392) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_CHAGL (Q8SN66) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDYIEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 390
>RBL_ANGLY (P28258) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDYIEKDRSRGIYFTQDWVSMPGVFPVASGGIHVWHMPAL 390
>RBL_ADICA (P36476) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 475 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D+IEKDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 351 DDYIEKDRSRGIYFTQDWVSMPGVFPVASGGIHVWHMPAL 390
>RBL_KIGAF (O98664) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 470 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 381
>RBL_PROLU (P28444) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 380
>RBL_POLSI (Q9GHP8) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_NELCA (P28433) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 380
>RBL_NANDO (O20241) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_JUSOD (P28428) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 380
>RBL_HARGR (P28420) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 380
>RBL_EREMA (Q33443) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_DRIWI (P28402) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFI+KDR+ G +F Q WVSMPGV PVASG IHVWHMPAL Sbjct: 341 DDFIQKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPAL 380
>RBL_CORMY (P28394) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_CERJA (Q05987) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_CALPL (P28388) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_BIXOR (O19872) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 381
>RBL_BERLA (P36481) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_BEAGR (O99001) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_BARPR (P28382) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 380
>RBL_AVECA (Q9MTE7) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_ASACA (P36479) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_AESPA (Q31827) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_ADOMO (P28378) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 466 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_TABHE (Q37282) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 469 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 381
>RBL_PACAQ (Q9XQJ6) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 469 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 344 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 383
>RBL_HELAN (P45738) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 485 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_FLAPR (P19162) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 485 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_FLABI (P19161) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 485 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_EUPAT (Q37192) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 485 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_COLPU (Q07210) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 469 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 345 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 384
>RBL_CEPOC (Q33323) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 469 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_BREMA (Q31738) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 469 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDFIEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_ANTLU (Q31672) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 469 Score = 70.9 bits (172), Expect = 9e-13 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFIEKDRSRGIYFTQDWVSLPGVXPVASGGIHVWHMPAL 381
>RBL_SESIN (P36487) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 317 DDFVEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 356
>RBL_BRAOL (P48686) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 479 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D++EKDR+ G FF Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_BOROF (Q05985) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 443 Score = 70.5 bits (171), Expect = 1e-12 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DFIEKDR G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 317 DDFIEKDRTRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 356
>RBL_ARATH (O03042) Ribulose bisphosphate carboxylase large chain precursor| (EC 4.1.1.39) (RuBisCO large subunit) Length = 479 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +D++EKDR+ G FF Q WVS+PGV PVASG IHVWHMPAL Sbjct: 351 DDYVEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPAL 390
>RBL_LUPPR (P69591) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPPO (P69590) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPPI (P69589) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPPE (P69588) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPPA (P69587) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPNO (P69586) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPNA (P92407) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPMU (P69585) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPMI (P92406) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPMC (P69584) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPLU (P69583) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPLA (P69582) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPHI (P69581) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPDI (P69580) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPDE (P92401) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPCO (P69579) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPAU (P69578) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPAT (P69577) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPAR (P69576) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPAN (P69575) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPAL (P92397) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPAE (P69574) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPAB (P69573) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_LUPAA (P69572) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 455 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 342 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 381
>RBL_ULMAL (Q33245) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_PASGU (P28438) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFVEKDRSRGIYFTQDWVSLPGVIPVASGGIHVWHMPAL 380
>RBL_ILECR (P28426) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380
>RBL_EUCUL (P28415) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) (Fragment) Length = 465 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 120 NDFIEKDRAXGXFFXQXWVSMPGVXPVASGXIHVWHMPAL 1 +DF+EKDR+ G +F Q WVS+PGV PVASG IHVWHMPAL Sbjct: 341 DDFVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPAL 380 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,804,585 Number of Sequences: 219361 Number of extensions: 186812 Number of successful extensions: 714 Number of sequences better than 10.0: 499 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 80,573,946 effective HSP length: 24 effective length of database: 75,309,282 effective search space used: 1807422768 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
