| Clone Name | rbasd19e09 |
|---|---|
| Clone Library Name | barley_pub |
>GLTB_MAIZE (P23225) Ferredoxin-dependent glutamate synthase, chloroplast| precursor (EC 1.4.7.1) (Fd-GOGAT) Length = 1616 Score = 78.2 bits (191), Expect = 1e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = -2 Query: 551 EWXAYLPLFWQLVPPSEEDSPEACAEFERVLARQKTAVQSAK 426 EW AYLPLFWQLVPPSEEDSPEACAEFERVLA+Q T SAK Sbjct: 1575 EWEAYLPLFWQLVPPSEEDSPEACAEFERVLAKQATTQLSAK 1616
>GLTB_SPIOL (Q43155) Ferredoxin-dependent glutamate synthase, chloroplast (EC| 1.4.7.1) (Fd-GOGAT) Length = 1517 Score = 55.1 bits (131), Expect = 1e-07 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -2 Query: 551 EWXAYLPLFWQLVPPSEEDSPEACAEFERVLARQKTAVQSA 429 +W YLPLFWQLVPPSEED+PEA A FE+ + + ++QSA Sbjct: 1478 DWDKYLPLFWQLVPPSEEDTPEASAMFEQ-MTSEGASLQSA 1517
>GLTB1_ARATH (Q9ZNZ7) Ferredoxin-dependent glutamate synthase 1, chloroplast| precursor (EC 1.4.7.1) (Fd-GOGAT 1) Length = 1648 Score = 53.5 bits (127), Expect = 4e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = -2 Query: 554 SEWXAYLPLFWQLVPPSEEDSPEACAEFERVLARQKT 444 +EW YLPLFWQLVPPSEED+PEA A + R + T Sbjct: 1608 NEWEKYLPLFWQLVPPSEEDTPEASAAYVRTSTGEVT 1644
>GLTB2_ARATH (Q9T0P4) Ferredoxin-dependent glutamate synthase 2, chloroplast| precursor (EC 1.4.7.1) (Fd-GOGAT 2) Length = 1629 Score = 45.8 bits (107), Expect = 8e-05 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 551 EWXAYLPLFWQLVPPSEEDSPEA 483 EW YL +FWQLVPPSEED+PEA Sbjct: 1584 EWDKYLAMFWQLVPPSEEDTPEA 1606
>GLTS_SYNY3 (P55038) Ferredoxin-dependent glutamate synthase 2 (EC 1.4.7.1)| (FD-GOGAT) Length = 1556 Score = 40.0 bits (92), Expect = 0.004 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 554 SEWXAYLPLFWQLVPPSEEDSPEA 483 + W YL FWQ VPPSE+DSPEA Sbjct: 1518 ANWSDYLGKFWQAVPPSEKDSPEA 1541
>GLTB_PORPU (P51375) Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)| (Fd-GOGAT) Length = 1538 Score = 34.7 bits (78), Expect = 0.19 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 548 WXAYLPLFWQLVPPSEEDSPE 486 W YLP FWQ+VPPSE + E Sbjct: 1505 WNTYLPQFWQVVPPSEANIEE 1525
>DMXL1_MOUSE (Q6PNC0) Protein DmX-like 1 (X-like 1 protein)| Length = 3013 Score = 32.3 bits (72), Expect = 0.93 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = -3 Query: 532 HSSGSWCHPAKKTLLKLVLSLREYLPGKKQLYNLLSDTSQS 410 +SS S HP KKTL + + SL + + GKK +++ D S Sbjct: 1267 NSSSSGLHPPKKTLTRSMTSLAQKICGKKSIFDPSVDMEDS 1307
>GLTB_CYACA (O19906) Ferredoxin-dependent glutamate synthase (EC 1.4.7.1)| (Fd-GOGAT) Length = 1549 Score = 32.0 bits (71), Expect = 1.2 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 551 EWXAYLPLFWQLVPPSEEDSPE 486 +W ++ FWQ+VPPSE ++ E Sbjct: 1516 QWEIFIHYFWQIVPPSESETSE 1537
>POTE1_MOUSE (Q91WC1) Protection of telomeres 1 (mPot1) (POT1-like telomere| end-binding protein) Length = 640 Score = 30.4 bits (67), Expect = 3.5 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 189 IYRGGCLGCKTLQKNPRRNLQARFQKMPWT 278 ++ GC C +L+ P +NL +RF K PWT Sbjct: 504 VHHYGCKQCSSLK--PIQNLNSRFHKGPWT 531
>DMXL1_HUMAN (Q9Y485) Protein DmX-like 1 (X-like 1 protein)| Length = 3027 Score = 29.3 bits (64), Expect = 7.9 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -3 Query: 529 SSGSWCHPAKKTLLKLVLSLREYLPGKKQLYNLLSDTSQS 410 +S S HP KKTL + + SL + + GKK ++ D S Sbjct: 1270 NSSSGLHPPKKTLTRSMTSLAQKICGKKTAFDPSVDMEDS 1309
>LASS1_HUMAN (P27544) LAG1 longevity assurance homolog 1 (UOG-1 protein) (LAG1| protein) Length = 350 Score = 29.3 bits (64), Expect = 7.9 Identities = 18/55 (32%), Positives = 24/55 (43%) Frame = -2 Query: 287 WKLCPRHLLETSLQIPSRILLQSLAT*ATTPVNWFADARLQGPALLNCCFLVQDS 123 W L R L E + P +LL +L T + A ARL P CC +D+ Sbjct: 42 WGLARRGLAEHAHLAPPELLLLALGALGWTALRSAATARLFRPLAKRCCLQPRDA 96 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,399,145 Number of Sequences: 219361 Number of extensions: 1481924 Number of successful extensions: 3841 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3841 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)