| Clone Name | rbasd18o21 |
|---|---|
| Clone Library Name | barley_pub |
>GPDA_CLOTE (Q895X7) Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)| (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase) Length = 349 Score = 32.7 bits (73), Expect = 0.91 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = -2 Query: 586 TLLKGRNAWYGQMLAKGELRLDMGDSIKGKGMI-QGISAVGAFFELLSQPSLSVLHPEEN 410 T + RN G ++ KG L M ++I+ GM+ +GI A AF+EL + +S+ Sbjct: 268 TSMHSRNRRAGLLIGKG---LSMEEAIEEVGMVVEGIKACKAFYELKEKLKVSM------ 318 Query: 409 KQVAPAXLCPILKRLYRILIKRE 341 PI LYR+L + E Sbjct: 319 ---------PITDALYRVLFQGE 332
>CO3A1_RAT (P13941) Collagen alpha-1(III) chain precursor| Length = 1463 Score = 30.4 bits (67), Expect = 4.5 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = -1 Query: 422 PRGKQASGSCXTVPNSEEAL*NSDKKGAPGXRHPPSPEGRNHERPS*EDRDGAEP 258 P+G+ P + N ++GAPG R P P G E+ +R G P Sbjct: 459 PKGEDGKDGSPGEPGANGVPGNPGERGAPGFRGPAGPNGAPGEKGPAGERGGPGP 513
>CTR1_HUMAN (P30825) High-affinity cationic amino acid transporter 1 (CAT-1)| (CAT1) (System Y+ basic amino acid transporter) (Ecotropic retroviral leukemia receptor homolog) (ERR) (Ecotropic retrovirus receptor homolog) Length = 629 Score = 30.0 bits (66), Expect = 5.9 Identities = 17/66 (25%), Positives = 26/66 (39%), Gaps = 2/66 (3%) Frame = +1 Query: 235 GETGGRMCGSAPSRSSHEGRSWFRPSGLGGCLXPGAPFLSEF--YKASSELGTVXQEPLA 408 G T GR+C + ++ G F P G G L A F + + G + P Sbjct: 225 GNTSGRLCLNNDTKEGKPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQK 284 Query: 409 CFPLGV 426 P+G+ Sbjct: 285 AIPVGI 290
>PHO85_YARLI (Q6C7U8) Negative regulator of the PHO system (EC 2.7.11.22)| (Serine/threonine-protein kinase PHO85) Length = 294 Score = 29.6 bits (65), Expect = 7.7 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 595 TYVTLLKGRNAWYGQMLAKGELRLD 521 TY T+ KGRN GQ++A E+ LD Sbjct: 17 TYATVYKGRNRTTGQLVALKEINLD 41
>PHO85_DEBHA (Q6BRY2) Negative regulator of the PHO system (EC 2.7.11.22)| (Serine/threonine-protein kinase PHO85) Length = 330 Score = 29.6 bits (65), Expect = 7.7 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 595 TYVTLLKGRNAWYGQMLAKGELRLD 521 TY T+ KGRN GQ++A E+ LD Sbjct: 18 TYATVYKGRNRTNGQLVALKEINLD 42 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,188,144 Number of Sequences: 219361 Number of extensions: 2214642 Number of successful extensions: 6057 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6050 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)