| Clone Name | rbasd19b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLMM_STRT2 (Q5M3V8) Phosphoglucosamine mutase (EC 5.4.2.10) | 31 | 2.9 | 2 | GLMM_STRT1 (Q5LZA7) Phosphoglucosamine mutase (EC 5.4.2.10) | 31 | 2.9 | 3 | FLHE_SALTY (P0A1N4) Flagellar protein flhE precursor | 29 | 8.3 | 4 | FLHE_SALTI (P0A1N5) Flagellar protein flhE precursor | 29 | 8.3 |
|---|
>GLMM_STRT2 (Q5M3V8) Phosphoglucosamine mutase (EC 5.4.2.10)| Length = 450 Score = 30.8 bits (68), Expect = 2.9 Identities = 19/56 (33%), Positives = 29/56 (51%) Frame = -2 Query: 511 YSDGIRSVEPAKFVASAGLSDGLLFTELDRPDGQPCVEAQEFSLVRNMFIAVVEER 344 Y +G+R E KF+ + GL G + LD +G V A+ L N IAV+ ++ Sbjct: 153 YPEGLRKYE--KFLVTTGLDLGGMKVALDAANGAAAVSARNIFLDLNAEIAVIGDQ 206
>GLMM_STRT1 (Q5LZA7) Phosphoglucosamine mutase (EC 5.4.2.10)| Length = 450 Score = 30.8 bits (68), Expect = 2.9 Identities = 19/56 (33%), Positives = 29/56 (51%) Frame = -2 Query: 511 YSDGIRSVEPAKFVASAGLSDGLLFTELDRPDGQPCVEAQEFSLVRNMFIAVVEER 344 Y +G+R E KF+ + GL G + LD +G V A+ L N IAV+ ++ Sbjct: 153 YPEGLRKYE--KFLVTTGLDLGGMKVALDAANGAAAVSARNIFLDLNAEIAVIGDQ 206
>FLHE_SALTY (P0A1N4) Flagellar protein flhE precursor| Length = 130 Score = 29.3 bits (64), Expect = 8.3 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +2 Query: 128 QSSPLHGFRTHFCIYTVQRGWSVDMGGGVITILRTEDNMIQIEYR 262 QS HGF + ++ W V GG +I L+ N + + YR Sbjct: 86 QSGTTHGFAHVPAVEPLRFVWEVPGGGRLIPALKVRSNQVIVNYR 130
>FLHE_SALTI (P0A1N5) Flagellar protein flhE precursor| Length = 130 Score = 29.3 bits (64), Expect = 8.3 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +2 Query: 128 QSSPLHGFRTHFCIYTVQRGWSVDMGGGVITILRTEDNMIQIEYR 262 QS HGF + ++ W V GG +I L+ N + + YR Sbjct: 86 QSGTTHGFAHVPAVEPLRFVWEVPGGGRLIPALKVRSNQVIVNYR 130 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,964,009 Number of Sequences: 219361 Number of extensions: 1775081 Number of successful extensions: 3959 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3959 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)