| Clone Name | rbasd18l24 |
|---|---|
| Clone Library Name | barley_pub |
>CSMD2_HUMAN (Q7Z408) CUB and sushi domain-containing protein 2 (CUB and sushi| multiple domains protein 2) Length = 3487 Score = 32.0 bits (71), Expect = 1.9 Identities = 19/64 (29%), Positives = 30/64 (46%) Frame = -3 Query: 500 DSGELRNGTKIILHIIIFVLWTRGQAIEASASLQGYCYASHFVELTDHLYWILDLRCYRV 321 D G ++NGT++ G ++ +S+ YC+ + VE T L IL V Sbjct: 1560 DPGSIKNGTRV------------GSDLKLGSSVTYYCHGGYEVEGTSTLSCILGPDGKPV 1607 Query: 320 WNSP 309 WN+P Sbjct: 1608 WNNP 1611
>WRK16_ARATH (Q9FL92) Probable WRKY transcription factor 16 (WRKY DNA-binding| protein 16) Length = 1372 Score = 31.6 bits (70), Expect = 2.4 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -2 Query: 564 TLAKQYVAMVQNMTHSCL--KSTRFRRTSQRHKNNTAHNYICVVDKGAGNRSICV 406 T +K+ +V N+ S + K R+ R KNN +CVVD+G+ + + V Sbjct: 1130 TESKKTDKLVDNIQSSMIATKEIEITRSKSRRKNNKEKRVVCVVDRGSRSSDLWV 1184
>PSL2_HUMAN (Q8TCT8) Signal peptide peptidase-like 2A (EC 3.4.23.-) (Protein| SPP-like 2A) (Protein SPPL2a) (Intramembrane protease 3) (IMP3) (Presenilin-like protein 2) Length = 520 Score = 30.0 bits (66), Expect = 7.1 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 7/58 (12%) Frame = +2 Query: 455 LCAVLFLCRCEVLLNLVDFKHECVIFCTIATYCFAK-------VSHFSHKICVSHCTV 607 L V+F+ C V++ L+ F ++ +++ IA +C A ++ HKI CT+ Sbjct: 221 LTVVIFVVICCVMMVLLYFFYKWLVYVMIAIFCIASAMSLYNCLAALIHKIPYGQCTI 278
>CFTR_DIDMA (Q2QL74) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1482 Score = 30.0 bits (66), Expect = 7.1 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -2 Query: 144 IEDNDKSPSELDGV*AMSVSKMPEIRAGEFICPRSSCINT 25 IE+ND P E +S +P+ GE I PRS+ INT Sbjct: 724 IEENDDEPLE------RRLSLVPDSEQGEAILPRSNIINT 757
>CFTR_TRIVU (Q5D1Z7) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1478 Score = 30.0 bits (66), Expect = 7.1 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -2 Query: 144 IEDNDKSPSELDGV*AMSVSKMPEIRAGEFICPRSSCINT 25 IE+ND P E +S +P+ GE I PRS+ INT Sbjct: 724 IEENDDEPLE------RRLSLVPDSEQGEAILPRSNMINT 757 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,662,692 Number of Sequences: 219361 Number of extensions: 1813965 Number of successful extensions: 3665 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3665 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7026286028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)