| Clone Name | rbasd19a18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ACHA4_PANTR (Q5IS77) Neuronal acetylcholine receptor protein, al... | 34 | 0.48 | 2 | ACHA4_HUMAN (P43681) Neuronal acetylcholine receptor protein, al... | 33 | 0.63 | 3 | COAA_CORGL (Q8NRQ2) Pantothenate kinase (EC 2.7.1.33) (Pantothen... | 30 | 6.9 |
|---|
>ACHA4_PANTR (Q5IS77) Neuronal acetylcholine receptor protein, alpha-4 subunit| precursor Length = 627 Score = 33.9 bits (76), Expect = 0.48 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 215 PLTSKKQHDTWARGPTTPPHSSQLPSSETAVAIRLQEFEAPVQNAKGG 358 PL ++K + GP PPH +Q P A ++ +Q +P + +GG Sbjct: 434 PLEAEKASPHASPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGG 481
>ACHA4_HUMAN (P43681) Neuronal acetylcholine receptor protein, alpha-4 subunit| precursor Length = 627 Score = 33.5 bits (75), Expect = 0.63 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 215 PLTSKKQHDTWARGPTTPPHSSQLPSSETAVAIRLQEFEAPVQNAKGG 358 PL ++K + GP PPH +Q P A ++ +Q +P + +GG Sbjct: 434 PLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGG 481
>COAA_CORGL (Q8NRQ2) Pantothenate kinase (EC 2.7.1.33) (Pantothenic acid| kinase) Length = 312 Score = 30.0 bits (66), Expect = 6.9 Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 10/110 (9%) Frame = -1 Query: 305 QLFHLRVIGSYV---EAWWVHVPMCRVVSWRLEAQYYLVRALIPLFGFTSLVMLAYII-- 141 ++ LR IG + E V++P+ R++ ++ A+ L A G + + + ++I Sbjct: 36 EVIELRGIGENIDLAEVAEVYLPLSRLIHLQVAARQQLTAATETFLGTSPSISVPFVIGV 95 Query: 140 ----FFGKSTTRGTYSILLSFDKKFPRVAYNDLALATG-KFSELNLVGRG 6 GKSTT +LL PRV DL G + L+ RG Sbjct: 96 AGSVAVGKSTTARLLQVLLQRWNSHPRV---DLVTTDGFLYPGAELIRRG 142 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,824,527 Number of Sequences: 219361 Number of extensions: 1864100 Number of successful extensions: 4436 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4436 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6856295237 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)