| Clone Name | rbasd18l10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DCAM_HORCH (Q42829) S-adenosylmethionine decarboxylase proenzyme... | 83 | 2e-16 | 2 | DCAM_MAIZE (O24575) S-adenosylmethionine decarboxylase proenzyme... | 58 | 7e-09 | 3 | DCAM_ORYSA (O24215) S-adenosylmethionine decarboxylase proenzyme... | 48 | 7e-06 | 4 | SMI1_YARLI (Q6CDX0) KNR4/SMI1 homolog | 28 | 5.7 |
|---|
>DCAM_HORCH (Q42829) S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50)| (AdoMetDC) (SamDC) [Contains: S-adenosylmethionine decarboxylase alpha chain; S-adenosylmethionine decarboxylase beta chain] Length = 393 Score = 82.8 bits (203), Expect = 2e-16 Identities = 42/49 (85%), Positives = 45/49 (91%), Gaps = 2/49 (4%) Frame = -1 Query: 334 APRSVFHCFEGENVESGHPLVKEGKLANLLAWRAEEDSLEE--GAVLCE 194 +PRSVFHCFE NVESGHPLVKEGKLANLLAWRAEE+SLEE GA+LCE Sbjct: 347 SPRSVFHCFE--NVESGHPLVKEGKLANLLAWRAEEESLEEGTGALLCE 393
>DCAM_MAIZE (O24575) S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50)| (AdoMetDC) (SamDC) [Contains: S-adenosylmethionine decarboxylase alpha chain; S-adenosylmethionine decarboxylase beta chain] Length = 400 Score = 57.8 bits (138), Expect = 7e-09 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -1 Query: 334 APRSVFHCFEGENVESG-HPLVKEGKLANLLAWRAEEDSLEEGA 206 +P+SVFHCF+GENVES P+ K+ KLANLL W E D++EE A Sbjct: 352 SPKSVFHCFDGENVESAPPPMKKDYKLANLLCWEEEADAMEEKA 395
>DCAM_ORYSA (O24215) S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50)| (AdoMetDC) (SamDC) [Contains: S-adenosylmethionine decarboxylase alpha chain; S-adenosylmethionine decarboxylase beta chain] Length = 398 Score = 47.8 bits (112), Expect = 7e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -1 Query: 334 APRSVFHCFEGENVESGHPLVKEGKLANLLAWRAEEDSLEE 212 +P+SV HCFE EN+ + P VKEGKL NLL W ED+LEE Sbjct: 354 SPKSVLHCFEAENMVNPAP-VKEGKLGNLLPW--GEDALEE 391
>SMI1_YARLI (Q6CDX0) KNR4/SMI1 homolog| Length = 713 Score = 28.1 bits (61), Expect = 5.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 286 GHPLVKEGKLANLLAWRAEEDSLEEGAV 203 G P+ + N+ +W A +DS+ EGAV Sbjct: 270 GSPVASVARQKNISSWLASQDSVPEGAV 297 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,826,761 Number of Sequences: 219361 Number of extensions: 609939 Number of successful extensions: 1794 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1791 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)