| Clone Name | rbasd19a01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CRI4_MAIZE (O24585) Putative receptor protein kinase CRINKLY4 pr... | 32 | 0.60 | 2 | DUS12_HUMAN (Q9UNI6) Dual specificity protein phosphatase 12 (EC... | 30 | 1.3 | 3 | DUS12_MOUSE (Q9D0T2) Dual specificity protein phosphatase 12 (EC... | 29 | 3.9 | 4 | DNAE2_MYCPA (Q73U92) Error-prone DNA polymerase (EC 2.7.7.7) | 28 | 8.7 | 5 | BNC1_HUMAN (Q01954) Zinc finger protein basonuclin-1 | 28 | 8.7 |
|---|
>CRI4_MAIZE (O24585) Putative receptor protein kinase CRINKLY4 precursor (EC| 2.7.11.1) Length = 901 Score = 31.6 bits (70), Expect = 0.60 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -3 Query: 174 QCFKKFAETAEKCVADNGIERPSMGDVLWNLEFALQM 64 + KK A A KCV G +RPSM V LE AL + Sbjct: 748 EALKKIASVACKCVRMRGKDRPSMDKVTTALEHALAL 784
>DUS12_HUMAN (Q9UNI6) Dual specificity protein phosphatase 12 (EC 3.1.3.48) (EC| 3.1.3.16) (Dual specificity tyrosine phosphatase YVH1) Length = 340 Score = 30.4 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = -1 Query: 164 RSLPRQLRSASPTTASNALRWEMCFGTWSLLFRCRKARR 48 ++LP++L + PTT S L+ E +L++CRK RR Sbjct: 195 QNLPQELFAVDPTTVSQGLKDE-------VLYKCRKCRR 226
>DUS12_MOUSE (Q9D0T2) Dual specificity protein phosphatase 12 (EC 3.1.3.48) (EC| 3.1.3.16) (Dual specificity phosphatase T-DSP4) (Dual specificity phosphatase VH1) Length = 339 Score = 28.9 bits (63), Expect = 3.9 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -1 Query: 161 SLPRQLRSASPTTASNALRWEMCFGTWSLLFRCRKARR 48 +LP++L + PTT S L+ + +L++CRK RR Sbjct: 195 NLPQELFAVDPTTISQGLKDD-------ILYKCRKCRR 225
>DNAE2_MYCPA (Q73U92) Error-prone DNA polymerase (EC 2.7.7.7)| Length = 1093 Score = 27.7 bits (60), Expect = 8.7 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Frame = -3 Query: 153 ETAEKCVADNGIERP--SMGDVLWNLEFALQMQESAEESGSFGC-GMS 19 + AEK V + P S+ D+ L+ ++Q E+ +G+FGC GMS Sbjct: 876 DLAEKLVQERKANGPFTSLLDLTARLQLSVQQTEALATAGAFGCFGMS 923
>BNC1_HUMAN (Q01954) Zinc finger protein basonuclin-1| Length = 994 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 6 ECPHLTSHSQSFRSPPRFPASEEQTPGSKA 95 +CP T S R PP +P S E + G A Sbjct: 439 KCPGFTVTSPDCRPPPSYPGSGEDSKGQPA 468 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,532,583 Number of Sequences: 219361 Number of extensions: 471372 Number of successful extensions: 1823 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1821 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)