| Clone Name | rbasd18k03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YPSE_SYNP2 (P31972) Hypothetical 22.7 kDa protein in psaE 5'region | 28 | 8.5 | 2 | CTR1_ARATH (Q05609) Serine/threonine-protein kinase CTR1 (EC 2.7... | 28 | 8.5 | 3 | BRE1_YEAST (Q07457) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-) (... | 28 | 8.5 |
|---|
>YPSE_SYNP2 (P31972) Hypothetical 22.7 kDa protein in psaE 5'region| Length = 205 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 Query: 48 LYMFIAAAQRSLRSCEASLAEHPSNGTNLA 137 LY ++ A LRS E +LA HP GTN++ Sbjct: 91 LYRAVSTAGDRLRSGEWNLAIHPRCGTNIS 120
>CTR1_ARATH (Q05609) Serine/threonine-protein kinase CTR1 (EC 2.7.11.1)| Length = 821 Score = 27.7 bits (60), Expect = 8.5 Identities = 19/58 (32%), Positives = 25/58 (43%) Frame = -1 Query: 193 PPIIHHDAFVSNAQNDYSHARLVPLEGCSASEASQLLSERWAAAMNMYNDPNDSXDKP 20 PPI+H D N D + V G S +AS LS + AA + P D+P Sbjct: 670 PPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKASTFLSSKSAAGTPEWMAPEVLRDEP 727
>BRE1_YEAST (Q07457) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-) (Brefeldin| A-sensitivity protein 1) Length = 700 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = -3 Query: 200 EPSSNYPS*CFCQQCSK*LQPCKISTIGRMFCQ*GFTASQ*TLGCCNEHV 51 E +N+ + +C CSK + I T G +FC+ CC E + Sbjct: 637 EELANFRTLVYCSLCSKNWKNMAIKTCGHVFCE----------NCCKERL 676 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,410,710 Number of Sequences: 219361 Number of extensions: 442545 Number of successful extensions: 1030 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1030 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)