| Clone Name | rbasd18j19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CSR1_ASHGO (Q757H2) Phosphatidylinositol transfer protein CSR1 | 32 | 1.3 | 2 | RARB_COTJA (Q9W6B3) Retinoic acid receptor beta (RAR-beta) | 30 | 6.7 | 3 | RARB_CHICK (P22448) Retinoic acid receptor beta (RAR-beta) | 30 | 6.7 | 4 | GLR35_ARATH (Q9SW97) Glutamate receptor 3.5 precursor (Ligand-ga... | 30 | 8.7 |
|---|
>CSR1_ASHGO (Q757H2) Phosphatidylinositol transfer protein CSR1| Length = 436 Score = 32.3 bits (72), Expect = 1.3 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +2 Query: 428 LAKTPLTMAKFIRACFPHLI*SCLGKIQA*HQAAWQIPP*WN 553 +A KF+ CF CLGK+ H+A W PP WN Sbjct: 263 MANMDYAPVKFLITCFEAHYPECLGKLFI-HKAPWIFPPIWN 303
>RARB_COTJA (Q9W6B3) Retinoic acid receptor beta (RAR-beta)| Length = 455 Score = 30.0 bits (66), Expect = 6.7 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 433 QDTLDNGKVHPSLLPPFNLELFREDPSLTPSCLADSSLMES 555 Q+ L+N + H L P N PS++PS + +SS+ +S Sbjct: 411 QEMLENSEGHEPLTPTSNGNTAEHSPSISPSSVDNSSVSQS 451
>RARB_CHICK (P22448) Retinoic acid receptor beta (RAR-beta)| Length = 455 Score = 30.0 bits (66), Expect = 6.7 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 433 QDTLDNGKVHPSLLPPFNLELFREDPSLTPSCLADSSLMES 555 Q+ L+N + H L P N PS++PS + +SS+ +S Sbjct: 411 QEMLENSEGHEPLTPTSNGNTAEHSPSISPSSVDNSSVSQS 451
>GLR35_ARATH (Q9SW97) Glutamate receptor 3.5 precursor (Ligand-gated ion channel| 3.5) (Ionotropic glutamate receptor GLR6) Length = 953 Score = 29.6 bits (65), Expect = 8.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 346 WSSFLLGFLCPLLWYYATTLYCCKYYNRDPRERP 245 W FL+ C ++W+ A TL+C K + + R RP Sbjct: 852 WGLFLI---CGVVWFIALTLFCWKVFWQYQRLRP 882 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,649,016 Number of Sequences: 219361 Number of extensions: 1740007 Number of successful extensions: 4369 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4368 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6598423128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)