| Clone Name | rbasd18h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MURC_PARUW (Q6MBS8) UDP-N-acetylmuramate--L-alanine ligase (EC 6... | 30 | 6.5 | 2 | CYSJ_BLOFL (Q7VQH2) Sulfite reductase [NADPH] flavoprotein alpha... | 30 | 8.5 | 3 | TYRP1_AMBME (P55027) 5,6-dihydroxyindole-2-carboxylic acid oxida... | 30 | 8.5 |
|---|
>MURC_PARUW (Q6MBS8) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 454 Score = 30.0 bits (66), Expect = 6.5 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = -1 Query: 437 RATLLVLATRESQKRSVTGSSRGATPSTPTVRTLATAHAITLCSRGGI 294 RA LL L TR+ + +VTG+ T S+ TL A+ + + GGI Sbjct: 91 RAELLALLTRQKKSLAVTGTHGKTTTSSLLATTLLEANCDSSFAVGGI 138
>CYSJ_BLOFL (Q7VQH2) Sulfite reductase [NADPH] flavoprotein alpha-component (EC| 1.8.1.2) (SIR-FP) Length = 610 Score = 29.6 bits (65), Expect = 8.5 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 214 IDRRRWVQVCGLPGVHHLRYDMIGQGLARKSGKAL 110 ++R++ L VHHL +D+ G GL + G AL Sbjct: 251 LNRQKITSCNSLKDVHHLEFDISGSGLCYQPGDAL 285
>TYRP1_AMBME (P55027) 5,6-dihydroxyindole-2-carboxylic acid oxidase precursor| (EC 1.14.18.-) (DHICA oxidase) (Tyrosinase-related protein 1) (TRP-1) (TRP1) Length = 534 Score = 29.6 bits (65), Expect = 8.5 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -1 Query: 371 GATPSTPTVRTLATAHAITLCSRGGIFNTIISFDTSS*CAENPMSGYNQ-KGRY 213 G + P V+ L + LC G+F+T + SS N + GY++ G+Y Sbjct: 316 GGNVARPMVQRLPEPQDVALCLEVGLFDTPPFYSNSSESFRNTVEGYSEPSGKY 369 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,713,745 Number of Sequences: 219361 Number of extensions: 2243031 Number of successful extensions: 6050 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6049 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6427774254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)