| Clone Name | rbasd18d05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YBJ5_YEAST (P38172) Protein YBL095W | 30 | 1.7 | 2 | VPH1_YEAST (P32563) Vacuolar ATP synthase subunit a, vacuolar is... | 30 | 1.7 | 3 | NAT1_YEAST (P12945) N-terminal acetyltransferase 1 (EC 2.3.1.88)... | 29 | 3.7 | 4 | K0195_HUMAN (Q12767) Protein KIAA0195 (Transmembrane protein 94) | 28 | 4.8 | 5 | Y177_TREPA (O83207) Hypothetical protein TP0177 | 28 | 6.3 |
|---|
>YBJ5_YEAST (P38172) Protein YBL095W| Length = 270 Score = 30.0 bits (66), Expect = 1.7 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = -2 Query: 202 PALQIFCQRQKLAESYTRSNCLLYKNVWREYF 107 P + F +Q++A+ + ++NC+L + W +YF Sbjct: 233 PHIWGFNHKQEMAKKFAKANCILVEPTWFKYF 264
>VPH1_YEAST (P32563) Vacuolar ATP synthase subunit a, vacuolar isoform (EC| 3.6.3.14) (V-ATPase a subunit) (Vacuolar proton pump a subunit) (V-ATPase 95 kDa subunit) (Vacuolar pH protein 1) Length = 839 Score = 30.0 bits (66), Expect = 1.7 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +3 Query: 30 LNKIDKSTIYDGQFLRDQLFVHFSTTKYSLHT-FLYNKQFDLVYDS-ASFWRWQKIWRAG 203 +NK+ + I+D F + + +S++T FLYN F S W+W W+ G Sbjct: 445 INKMKRGEIFDMAFTGRYIILLMGV--FSMYTGFLYNDIFSKTMTIFKSGWKWPDHWKKG 502 Query: 204 RQSPLTN*GQNP 239 T+ G P Sbjct: 503 ESITATSVGTYP 514
>NAT1_YEAST (P12945) N-terminal acetyltransferase 1 (EC 2.3.1.88)| (Amino-terminal, alpha-amino, acetyltransferase 1) Length = 853 Score = 28.9 bits (63), Expect = 3.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 7/41 (17%) Frame = -2 Query: 226 QFVSGDWRPALQIFCQRQKLAES-------YTRSNCLLYKN 125 Q V+G+ + A+ Q +KLAE Y S CL+YKN Sbjct: 168 QDVNGERQQAINTLSQFEKLAEGKISDSEKYEHSECLMYKN 208
>K0195_HUMAN (Q12767) Protein KIAA0195 (Transmembrane protein 94)| Length = 1356 Score = 28.5 bits (62), Expect = 4.8 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -2 Query: 151 RSNCLLYKNVWREYFVVLK*TNNWSLRNWP-SYIVDLSILLRL 26 R CL +K VWR F L +N S +WP + ++ L++LL L Sbjct: 41 RKKCLTWKEVWRSSF--LHHSNRCSCFHWPGASLMLLAVLLLL 81
>Y177_TREPA (O83207) Hypothetical protein TP0177| Length = 436 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = +3 Query: 105 TKYSLHTFLYNKQFDLVYDSASFWRWQ---KIWRAGRQS 212 T SLH+FL N D + +F W+ +IWRA QS Sbjct: 42 TARSLHSFLINHIPDELLGQTAFVPWEPANRIWRAQAQS 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,143,670 Number of Sequences: 219361 Number of extensions: 586070 Number of successful extensions: 1456 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1456 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)