| Clone Name | rbasd17o02 |
|---|---|
| Clone Library Name | barley_pub |
>CBF5_CANAL (O43101) Centromere/microtubule-binding protein CBF5| (Centromere-binding factor 5) (Small nucleolar RNP protein CBF5) (H/ACA snoRNP protein CBF5) Length = 479 Score = 31.6 bits (70), Expect = 2.1 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -2 Query: 622 KSEKADSQKAKDIKSEKGGLQKATKTKVKRKHRDEDLEQEKR 497 K EK D ++ K+ K +K +K K + KRK D+ + EK+ Sbjct: 432 KKEKKDKKEKKEKKDKKEKKEKKDKKEKKRKAEDDSSKSEKK 473
>CCD11_MOUSE (Q9D439) Coiled-coil domain-containing protein 11| Length = 399 Score = 31.2 bits (69), Expect = 2.8 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = -2 Query: 619 SEKADSQKAKDIKSEKGGLQKATKTKVKRKHRDEDLEQEKRNNFTFFAFKDPV 461 S +A Q A+ +K E+ + + K ++KR+ E L+++KR T + K V Sbjct: 125 SIQAQRQGARRMKEEEARILEQNKAQIKREDEQEKLQKQKRRQETRSSLKKAV 177
>NMT1_RAT (Q8K1Q0) Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97)| (Peptide N-myristoyltransferase 1) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase) Length = 496 Score = 30.8 bits (68), Expect = 3.6 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -2 Query: 610 ADSQKAKDIKSEKGGLQKATKTKVKRKHRDEDLEQEKRNN 491 +D + +DI +GGL A T K+K + + ++EK N+ Sbjct: 31 SDCENEEDISHNRGGLSPANDTGAKKKKKKQKKKKEKGND 70
>MAN1_YEAST (P22855) Alpha-mannosidase (EC 3.2.1.24) (Alpha-D-mannoside| mannohydrolase) Length = 1083 Score = 30.0 bits (66), Expect = 6.2 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = -2 Query: 130 LYSFSSLKYVSGPFTVPVLSYTVSKCA---NFVICKQCIITTVMS 5 LYS + KYV+ P V V T KCA F I ++C I +V+S Sbjct: 769 LYSVNQYKYVTKPKKVQVSCNTKEKCAVEVIFQISEKCKIKSVIS 813
>RBBP6_MOUSE (P97868) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) Length = 1790 Score = 29.6 bits (65), Expect = 8.0 Identities = 20/52 (38%), Positives = 26/52 (50%) Frame = -2 Query: 640 QXVQLSKSEKADSQKAKDIKSEKGGLQKATKTKVKRKHRDEDLEQEKRNNFT 485 Q + +K EK +KDIKSEK K K K K++ D + EKR T Sbjct: 1101 QEAKPAKDEKVKKDCSKDIKSEKPA-SKDEKAKKPEKNKLLDSKGEKRKRKT 1151 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,770,214 Number of Sequences: 219361 Number of extensions: 2044233 Number of successful extensions: 5536 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5533 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6086476506 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)