| Clone Name | rbasd18b13 |
|---|---|
| Clone Library Name | barley_pub |
>FXL14_MOUSE (Q8BID8) F-box/LRR-repeat protein 14 (F-box and leucine-rich repeat| protein 14) Length = 400 Score = 37.0 bits (84), Expect = 0.012 Identities = 22/41 (53%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = -3 Query: 363 IISGLTSLVSLNLSY-SRVSNAGLHHLRPLQNLRSLSLDSC 244 I GLT L LNLS+ +S+AGL HL + +LRSL+L SC Sbjct: 223 ISRGLTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSC 263
>FXL14_HUMAN (Q8N1E6) F-box/LRR-repeat protein 14 (F-box and leucine-rich repeat| protein 14) Length = 418 Score = 37.0 bits (84), Expect = 0.012 Identities = 22/41 (53%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = -3 Query: 363 IISGLTSLVSLNLSY-SRVSNAGLHHLRPLQNLRSLSLDSC 244 I GLT L LNLS+ +S+AGL HL + +LRSL+L SC Sbjct: 223 ISRGLTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSC 263
>TLR13_MOUSE (Q6R5N8) Toll-like receptor 13 precursor| Length = 991 Score = 33.1 bits (74), Expect = 0.17 Identities = 24/69 (34%), Positives = 33/69 (47%) Frame = -3 Query: 357 SGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKVTACEVKKLQLAALPNLVSVR 178 SGLT+L SL+L Y+ +S H L+ L L L K+T + LQ L S++ Sbjct: 537 SGLTNLRSLDLMYNSLSYFHEHLFSGLEKLLILKLGFNKITYETTRTLQYPPFIKLKSLK 596 Query: 177 PE*SSGNRH 151 G RH Sbjct: 597 QLNLEGQRH 605
>CPN2_MOUSE (Q9DBB9) Carboxypeptidase N subunit 2 precursor (Carboxypeptidase N| polypeptide 2) (Carboxypeptidase N 83 kDa chain) (Carboxypeptidase N regulatory subunit) (Carboxypeptidase N large subunit) Length = 547 Score = 33.1 bits (74), Expect = 0.17 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = -3 Query: 357 SGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKVTA 232 + L+ LVSL LS++ +++ H R L+ L LSLDS +TA Sbjct: 310 TNLSRLVSLTLSHNAITDLPEHVFRNLEQLVKLSLDSNNLTA 351
>LRFN5_MOUSE (Q8BXA0) Leucine-rich repeat and fibronectin type-III| domain-containing protein 5 precursor Length = 719 Score = 31.6 bits (70), Expect = 0.49 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = -3 Query: 357 SGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKVT 235 + +TSLV L LS + +S H L+NLR+L L+S ++T Sbjct: 72 ANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLT 112
>LRFN5_HUMAN (Q96NI6) Leucine-rich repeat and fibronectin type-III| domain-containing protein 5 precursor Length = 719 Score = 31.6 bits (70), Expect = 0.49 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = -3 Query: 357 SGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKVT 235 + +TSLV L LS + +S H L+NLR+L L+S ++T Sbjct: 72 ANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLT 112
>FXL13_HUMAN (Q8NEE6) F-box/LRR-repeat protein 13 (F-box and leucine-rich repeat| protein 13) Length = 735 Score = 30.8 bits (68), Expect = 0.83 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = -3 Query: 360 ISGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDSC 244 I + SLVS++LS + +SN GL+ L + L+ LS+ C Sbjct: 526 IVNIFSLVSIDLSGTDISNEGLNVLSRHKKLKELSVSEC 564
>AN32D_HUMAN (O95626) Acidic leucine-rich nuclear phosphoprotein 32 family| member D (Tumorigenic protein pp32r2) Length = 131 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -3 Query: 345 SLVSLNLSYSRVSNAG-LHHLRPLQNLRSLSLDSCKVT 235 +L+ LNLS +++ + + L+ L+NL SL L +C+VT Sbjct: 89 NLIHLNLSGNKIKDLSTIEPLKKLENLESLDLFTCEVT 126
>AMGO3_RAT (Q80ZD5) Amphoterin-induced protein 3 precursor (AMIGO-3)| (Alivin-3) Length = 508 Score = 30.0 bits (66), Expect = 1.4 Identities = 26/82 (31%), Positives = 34/82 (41%) Frame = -3 Query: 369 LXIISGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKVTACEVKKLQLAALPNL 190 L GL+ L L LS + +S+ +HL L R +LD V +LAALP Sbjct: 150 LDAFQGLSMLSHLYLSCNELSSFSFNHLHGLGLTRLRTLDLSSNWLGHVSVPELAALPTF 209 Query: 189 VSVRPE*SSGNRHLPSTCKYDH 124 + R N LP C H Sbjct: 210 LKNRL--YLHNNPLPCDCSLYH 229
>RELN_MOUSE (Q60841) Reelin precursor (EC 3.4.21.-) (Reeler protein)| Length = 3461 Score = 30.0 bits (66), Expect = 1.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 275 CSGLRWWRPAFDTREYDRFS 334 C+ RWW+P F +YD+++ Sbjct: 1195 CTRFRWWKPVFSGEDYDQWA 1214
>AN32A_HUMAN (P39687) Acidic leucine-rich nuclear phosphoprotein 32 family| member A (Potent heat-stable protein phosphatase 2A inhibitor I1PP2A) (Acidic nuclear phosphoprotein pp32) (Cerebellar leucine-rich acidic nuclear protein) (HLA-DR-associated prote Length = 249 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -3 Query: 345 SLVSLNLSYSRVSNAG-LHHLRPLQNLRSLSLDSCKVT 235 +L LNLS +++ + + L+ L+NL+SL L +C+VT Sbjct: 89 NLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVT 126
>RELN_HUMAN (P78509) Reelin precursor (EC 3.4.21.-)| Length = 3460 Score = 29.6 bits (65), Expect = 1.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 275 CSGLRWWRPAFDTREYDRFS 334 C+ RWW+P F +YD+++ Sbjct: 1194 CTRFRWWQPVFSGEDYDQWA 1213
>TSG6_HUMAN (P98066) Tumor necrosis factor-inducible protein TSG-6 precursor| (TNF-stimulated gene 6 protein) (Hyaluronate-binding protein) Length = 277 Score = 29.6 bits (65), Expect = 1.8 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +3 Query: 33 SSVYHQINPCRNSQDYVCTDAQARSACSTRGGHIYTWTEGACYRKTTPDARLPGW 197 + VYH+ S Y T A+A++ C GGH+ T+ + RK GW Sbjct: 35 AGVYHRE---ARSGKYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGW 86
>RELN_RAT (P58751) Reelin precursor (EC 3.4.21.-)| Length = 3462 Score = 29.6 bits (65), Expect = 1.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 275 CSGLRWWRPAFDTREYDRFS 334 C+ RWW+P F +YD+++ Sbjct: 1196 CTRFRWWQPVFSGEDYDQWA 1215
>SYV_MYCPN (P75304) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 838 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 202 GGQLKLLDLAGRHLARVERQRAQVLQRPQMVEACVRHP 315 G Q+K++D A +LA +E+QR+ L Q +A +P Sbjct: 762 GFQIKIVDNAANNLAHLEKQRSFYLAEVQRSQAITTNP 799
>PGIP1_ORYSA (Q8GT95) Polygalacturonase inhibitor 1 precursor| (Polygalacturonase-inhibiting protein) (Floral organ regulator 1) Length = 332 Score = 29.3 bits (64), Expect = 2.4 Identities = 16/44 (36%), Positives = 27/44 (61%) Frame = -3 Query: 360 ISGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKVTAC 229 ++ + SL S++LS++ ++ + L NLRSL L S K+T C Sbjct: 140 LARIRSLDSVDLSHNSLTGPIPNSFSDLPNLRSLDLRSNKLTGC 183
>AROKB_BIFLO (Q8G5X4) Bifunctional shikimate kinase/3-dehydroquinate synthase| [Includes: Shikimate kinase (EC 2.7.1.71) (SK); 3-dehydroquinate synthase (EC 4.2.3.4)] Length = 540 Score = 29.3 bits (64), Expect = 2.4 Identities = 22/79 (27%), Positives = 32/79 (40%), Gaps = 16/79 (20%) Frame = +1 Query: 94 RRPVLPALLGVVIFTRG----------------RKVPVTGRLLRTHAYQVGEGGQLKLLD 225 R PV + V + TRG R V VTG + + +GEG L+D Sbjct: 142 RDPVFREVANVHVHTRGLTPQGAAKKVIDMVSERAVHVTGAAIEPYDVVIGEGAMNHLVD 201 Query: 226 LAGRHLARVERQRAQVLQR 282 + G A++ Q +QR Sbjct: 202 VLGPKPAKIALIHTQPVQR 220
>FRPC_NEIMC (P55127) Iron-regulated protein frpC| Length = 1829 Score = 28.9 bits (63), Expect = 3.2 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = -3 Query: 339 VSLNLSYSRVSN-AGLHHLRPLQNLRSLSLDSCKV----TACEVKKLQLAALPNLV 187 V L ++ +N AG+ LR L+ +LS D + +A E K+ QLA L NL+ Sbjct: 595 VELTAEQAKAANLAGIGRLRDLREAAALSGDLANMLKAYSAAETKEAQLALLDNLI 650
>FRPC_NEIMB (Q9JYV5) Iron-regulated protein frpC| Length = 1829 Score = 28.9 bits (63), Expect = 3.2 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = -3 Query: 339 VSLNLSYSRVSN-AGLHHLRPLQNLRSLSLDSCKV----TACEVKKLQLAALPNLV 187 V L ++ +N AG+ LR L+ +LS D + +A E K+ QLA L NL+ Sbjct: 595 VELTAEQAKAANLAGIGRLRDLREAAALSGDLANMLKAYSAAETKEAQLALLDNLI 650
>FRPA_NEIMB (Q9K0K9) Iron-regulated protein frpA| Length = 1302 Score = 28.9 bits (63), Expect = 3.2 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = -3 Query: 339 VSLNLSYSRVSN-AGLHHLRPLQNLRSLSLDSCKV----TACEVKKLQLAALPNLV 187 V L ++ +N AG+ LR L+ +LS D + +A E K+ QLA L NL+ Sbjct: 468 VELTAEQAKAANLAGIGRLRDLREAAALSGDLANMLKAYSAAETKEAQLALLDNLI 523
>AN32A_RAT (P49911) Acidic leucine-rich nuclear phosphoprotein 32 family| member A (Leucine-rich acidic nuclear protein) Length = 247 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -3 Query: 345 SLVSLNLSYSRVSNAG-LHHLRPLQNLRSLSLDSCKVT 235 +L LNLS +++ + + L+ L+NL+SL L +C+VT Sbjct: 89 NLKHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVT 126
>AN32A_MOUSE (O35381) Acidic leucine-rich nuclear phosphoprotein 32 family| member A (Potent heat-stable protein phosphatase 2A inhibitor I1PP2A) (Acidic nuclear phosphoprotein pp32) (Cerebellar leucine-rich acidic nuclear protein) Length = 247 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -3 Query: 345 SLVSLNLSYSRVSNAG-LHHLRPLQNLRSLSLDSCKVT 235 +L LNLS +++ + + L+ L+NL+SL L +C+VT Sbjct: 89 NLKHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVT 126
>TLR22_CHICK (Q9DGB6) Toll-like receptor 2 type-2 precursor| Length = 781 Score = 28.9 bits (63), Expect = 3.2 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 7/61 (11%) Frame = -3 Query: 354 GLTSLVS-LNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKVTACEVK------KLQLAALP 196 GLT ++ LNL+++R+ H L+ NLR+L L S ++++ + KL+L L Sbjct: 49 GLTGKITVLNLAHNRIKVIRTHDLQKAVNLRTLLLQSNQISSIDEDSFGSQGKLELLDLS 108 Query: 195 N 193 N Sbjct: 109 N 109
>TLR21_CHICK (Q9DD78) Toll-like receptor 2 type-1 precursor| Length = 793 Score = 28.9 bits (63), Expect = 3.2 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 7/61 (11%) Frame = -3 Query: 354 GLTSLVS-LNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKVTACEVK------KLQLAALP 196 GLT ++ LNL+++R+ H L+ NLR+L L S ++++ + KL+L L Sbjct: 60 GLTGKITVLNLAHNRIKLIRTHDLQKAVNLRTLLLQSNQISSIDEDSFGSQGKLELLDLS 119 Query: 195 N 193 N Sbjct: 120 N 120
>NAL14_HUMAN (Q86W24) NACHT-, LRR- and PYD-containing protein 14| (Nucleotide-binding oligomerization domain protein 5) Length = 1093 Score = 28.9 bits (63), Expect = 3.2 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 5/56 (8%) Frame = -3 Query: 345 SLVSLNLSYSRVSNAGLHHL-----RPLQNLRSLSLDSCKVTACEVKKLQLAALPN 193 SL+ LNLS + + + G+ L P L LSL+SC +T + L LA + N Sbjct: 787 SLIFLNLSTNNLLDDGVQLLCEALRHPKCYLERLSLESCGLTEAGCEYLSLALISN 842
>MEP1A_HUMAN (Q16819) Meprin A alpha-subunit precursor (EC 3.4.24.18)| (Endopeptidase-2) (N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase alpha subunit) (PABA peptide hydrolase) (PPH alpha) Length = 746 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +3 Query: 54 NPCRNSQDYVCTDAQARSACSTRGGHIYTWTEGAC 158 NPC+N D +C + + ++C GH + +T C Sbjct: 677 NPCQN--DGICVNVKGMASCRCISGHAFFYTGERC 709
>FRPA_NEIMC (P55126) Iron-regulated protein frpA| Length = 1115 Score = 28.9 bits (63), Expect = 3.2 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = -3 Query: 339 VSLNLSYSRVSN-AGLHHLRPLQNLRSLSLDSCKV----TACEVKKLQLAALPNLV 187 V L ++ +N AG+ LR L+ +LS D + +A E K+ QLA L NL+ Sbjct: 481 VELTAEQAKAANLAGIGRLRDLREAAALSGDLANMLKAYSAAETKEAQLALLDNLI 536
>YH14_YEAST (P38897) Hypothetical protein YHR214W| Length = 203 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 157 VTGRLLRTHAYQVGEGGQLKLLD 225 VTG+++ T A +V GG+L LLD Sbjct: 74 VTGKVIATEAVEVAAGGKLTLLD 96
>Y2473_LISMO (P58588) Hypothetical UPF0052 protein lmo2473| Length = 322 Score = 28.1 bits (61), Expect = 5.4 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Frame = +1 Query: 115 LLGVVIFTRGRKVPVTGRLLRTHAYQVGEGGQL----KLLDLAGRHLARVERQRAQVLQR 282 +L V+ RG+ +P T + L +A E G + L+ L G+H+ RV + V Sbjct: 114 VLATVLKIRGKVIPATDQPLILNAEM--EDGSIVHGESLIPLQGKHINRVYIEPENVKPY 171 Query: 283 PQMVEA 300 P VEA Sbjct: 172 PTAVEA 177
>MUC2_RAT (Q62635) Mucin-2 precursor (Intestinal mucin 2) (Fragment)| Length = 1513 Score = 28.1 bits (61), Expect = 5.4 Identities = 10/34 (29%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 60 CRNSQDYVCTDAQARS-ACSTRGGHIYTWTEGAC 158 C+N++D +C + + AC+ +G ++ W E C Sbjct: 618 CQNNEDCMCAALSSYARACAAKGVMLWGWRESVC 651
>LRIG1_MOUSE (P70193) Leucine-rich repeats and immunoglobulin-like domains| protein 1 precursor (LIG-1) Length = 1091 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -3 Query: 336 SLNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKVTA 232 SLNLSY+R+S L NL+ + L+S ++TA Sbjct: 74 SLNLSYNRLSEIDSAAFEDLTNLQEVYLNSNELTA 108
>RELN_CHICK (O93574) Reelin (EC 3.4.21.-) (Fragment)| Length = 3209 Score = 28.1 bits (61), Expect = 5.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 275 CSGLRWWRPAFDTREYDRFS 334 C+ RWW+P F YD+++ Sbjct: 942 CTRFRWWQPVFSGEGYDQWA 961
>SLIT_DROME (P24014) Protein slit precursor [Contains: Protein slit N-product;| Protein slit C-product] Length = 1504 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -3 Query: 357 SGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKVT 235 + LT L +L +SY+++ H L L NLR LSL +++ Sbjct: 811 ANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRIS 851
>PALB_EMENI (Q00204) Calpain-like protease palB (EC 3.4.22.-) (Cysteine| protease palB) Length = 847 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 78 YVCTDAQARSACSTRGGHIYTWTEGACYRKTTPDARLP 191 Y C +S S G +I+ + C+RK D RLP Sbjct: 224 YPCIHNSMKSDISPSGKYIFRFYFNGCFRKVVIDDRLP 261
>AN32E_HUMAN (Q9BTT0) Acidic leucine-rich nuclear phosphoprotein 32 family| member E (LANP-like protein) (LANP-L) Length = 268 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/41 (36%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = -3 Query: 345 SLVSLNLSYSRVSNAG-LHHLRPLQNLRSLSLDSCKVTACE 226 +L LNLS +++ + + L+ L+NL+SL L +C++T E Sbjct: 89 NLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLE 129
>AMGO3_MOUSE (Q8C2S7) Amphoterin-induced protein 3 precursor (AMIGO-3)| (Alivin-3) Length = 508 Score = 28.1 bits (61), Expect = 5.4 Identities = 25/82 (30%), Positives = 33/82 (40%) Frame = -3 Query: 369 LXIISGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKVTACEVKKLQLAALPNL 190 L GL L L LS + +S+ +HL L R +LD + +LAALP Sbjct: 150 LDAFQGLRMLSHLYLSCNELSSFSFNHLHGLGLTRLRTLDLSSNWLKHISIPELAALPTY 209 Query: 189 VSVRPE*SSGNRHLPSTCKYDH 124 + R N LP C H Sbjct: 210 LKNRL--YLHNNPLPCDCSLYH 229
>TLR2_CANFA (Q689D1) Toll-like receptor 2 precursor (CD282 antigen)| Length = 785 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -3 Query: 351 LTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSL 253 L SL L+LSY+ +SN RPL +L+ L+L Sbjct: 100 LWSLEHLDLSYNLLSNLSSSWFRPLSSLKFLNL 132
>AN32E_MOUSE (P97822) Acidic leucine-rich nuclear phosphoprotein 32 family| member E (LANP-like protein) (LANP-L) (Cerebellar postnatal development protein 1) Length = 260 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/41 (36%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = -3 Query: 345 SLVSLNLSYSRVSNAG-LHHLRPLQNLRSLSLDSCKVTACE 226 +L LNLS +++ + + L+ L+NL+SL L +C++T E Sbjct: 89 NLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLE 129
>AN32A_BOVIN (P51122) Acidic leucine-rich nuclear phosphoprotein 32 family| member A (Leucine-rich acidic nuclear protein) (Fragments) Length = 173 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -3 Query: 345 SLVSLNLSYSRVSNAG-LHHLRPLQNLRSLSLDSCKVT 235 +L LNL +++ + + L+ L+NL+SL L +C+VT Sbjct: 86 NLTHLNLRGNKIKDLSTIEPLKKLENLKSLDLFNCEVT 123
>TLE4_RAT (Q07141) Transducin-like enhancer protein 4 (ESP2 protein)| Length = 741 Score = 27.7 bits (60), Expect = 7.0 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Frame = +3 Query: 12 HKQXDIN---SSVYHQINPCRNSQDYVCTDAQARSACSTRGGHIYTWTEGACYRKTTP 176 HKQ +I +++ Q+ PC SQ+ AQ H+ TWT AC TTP Sbjct: 75 HKQAEIVKRLNAICAQVIPCL-SQEQQQLQAQ----------HLLTWTWSACASDTTP 121
>RL15_SYNEL (Q8DML6) 50S ribosomal protein L15| Length = 154 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 241 GDGLRGQEASAGRPPQPG 188 G G+RGQ++ +GRP +PG Sbjct: 32 GFGMRGQKSRSGRPTRPG 49
>DRL42_ARATH (Q9FKZ1) Probable disease resistance protein At5g66900| Length = 809 Score = 27.7 bits (60), Expect = 7.0 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 5/62 (8%) Frame = -3 Query: 360 ISGLTSLVSLNLSY-----SRVSNAGLHHLRPLQNLRSLSLDSCKVTACEVKKLQLAALP 196 ISG+ L L ++ +R+SN L L NL+ + L+ +T ++ +LQL++L Sbjct: 566 ISGMKKLKVLTITNHGFYPARLSNFSC--LSSLPNLKRIRLEKVSITLLDIPQLQLSSLK 623 Query: 195 NL 190 L Sbjct: 624 KL 625
>Y2616_LISIN (Q928C0) Hypothetical UPF0052 protein lin2616| Length = 322 Score = 27.7 bits (60), Expect = 7.0 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Frame = +1 Query: 115 LLGVVIFTRGRKVPVTGRLLRTHAYQVGEGGQL----KLLDLAGRHLARVERQRAQVLQR 282 +L V+ RG+ +P T + L +A E G + L+ L G+H+ RV + V Sbjct: 114 VLATVLKIRGKVIPATDQPLILNAEM--EDGSIVHGESLIPLQGKHINRVFIEPENVKPY 171 Query: 283 PQMVEA 300 P VEA Sbjct: 172 PTAVEA 177
>ALS2_PANTR (Q5BIW4) Alsin (Amyotrophic lateral sclerosis protein 2 homolog)| Length = 1657 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = +3 Query: 90 DAQARSACSTRG----GHIYTWTEGACYRKTTPDARLPGWGG 203 D++ RS+ G G ++ W G+ TP+ RLPGWGG Sbjct: 2 DSKKRSSTEAEGSKERGLVHIWQAGSF--PITPE-RLPGWGG 40
>ALS2_HUMAN (Q96Q42) Alsin (Amyotrophic lateral sclerosis protein 2)| Length = 1657 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = +3 Query: 90 DAQARSACSTRG----GHIYTWTEGACYRKTTPDARLPGWGG 203 D++ RS+ G G ++ W G+ TP+ RLPGWGG Sbjct: 2 DSKKRSSTEAEGSKERGLVHIWQAGSF--PITPE-RLPGWGG 40
>RL15_SYNPX (Q7U4I3) 50S ribosomal protein L15| Length = 152 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 241 GDGLRGQEASAGRPPQPG 188 G G+RGQ++ +GRP +PG Sbjct: 35 GFGMRGQKSRSGRPTRPG 52
>RL15_PROMP (Q7UZW1) 50S ribosomal protein L15| Length = 152 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 241 GDGLRGQEASAGRPPQPG 188 G G+RGQ++ +GRP +PG Sbjct: 34 GFGMRGQKSRSGRPTRPG 51
>RL15_PROMM (Q7V528) 50S ribosomal protein L15| Length = 151 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 241 GDGLRGQEASAGRPPQPG 188 G G+RGQ++ +GRP +PG Sbjct: 35 GFGMRGQKSRSGRPTRPG 52
>RL15_PROMA (Q7V9X9) 50S ribosomal protein L15| Length = 151 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 241 GDGLRGQEASAGRPPQPG 188 G G+RGQ++ +GRP +PG Sbjct: 35 GFGMRGQKSRSGRPTRPG 52
>LRFN2_MOUSE (Q80TG9) Leucine-rich repeat and fibronectin type-III| domain-containing protein 2 precursor Length = 788 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -3 Query: 357 SGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDS 247 + +T LV L LS + +S+ L++LRSL LDS Sbjct: 73 ANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDS 109
>LRFN2_MACFA (Q9BE71) Leucine-rich repeat and fibronectin type-III| domain-containing protein 2 precursor Length = 789 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -3 Query: 357 SGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDS 247 + +T LV L LS + +S+ L++LRSL LDS Sbjct: 73 ANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDS 109
>LRFN2_HUMAN (Q9ULH4) Leucine-rich repeat and fibronectin type-III| domain-containing protein 2 precursor Length = 789 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -3 Query: 357 SGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDS 247 + +T LV L LS + +S+ L++LRSL LDS Sbjct: 73 ANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDS 109
>RINI_MOUSE (Q91VI7) Ribonuclease inhibitor (Ribonuclease/angiogenin inhibitor| 1) Length = 456 Score = 27.7 bits (60), Expect = 7.0 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 5/55 (9%) Frame = -3 Query: 363 IISGLTSLVSLNLSYSRVSNAGLHH-----LRPLQNLRSLSLDSCKVTACEVKKL 214 +++ SL L+LS +++ NAG+ L P LR+L L C +TA K L Sbjct: 217 VVASKASLQELDLSSNKLGNAGIAALCPGLLLPSCKLRTLWLWECDITAEGCKDL 271
>LRRK1_MOUSE (Q3UHC2) Leucine-rich repeat serine/threonine-protein kinase 1 (EC| 2.7.11.1) Length = 2014 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 11/69 (15%) Frame = -3 Query: 354 GLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLD-----------SCKVTACEVKKLQL 208 GL L L+L+ +R++ + + ++L SL++ SC + C+ K L Sbjct: 378 GLRKLQELDLADNRLTELPVQFMHSFKSLTSLNVSRNNLKSFPDPWSCPLKCCKASKNAL 437 Query: 207 AALPNLVSV 181 +LP+ ++V Sbjct: 438 ESLPDKMAV 446
>DRL30_ARATH (Q9LZ25) Probable disease resistance protein At5g04720| Length = 811 Score = 27.7 bits (60), Expect = 7.0 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = -3 Query: 363 IISGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKV-TACEVKKLQLAAL-PNL 190 I + L L SL L V + PLQNL LSL CK+ T+ + +L +A + P L Sbjct: 595 IFTNLAKLKSLWLQRVHVPELSSSTV-PLQNLHKLSLIFCKINTSLDQTELDIAQIFPKL 653 Query: 189 VSVRPE*SSGNRHLPST 139 + + LPST Sbjct: 654 SDLTIDHCDDLLELPST 670
>RL15_SYNP7 (P31160) 50S ribosomal protein L15| Length = 147 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 241 GDGLRGQEASAGRPPQPG 188 G G+RGQ++ +GRP +PG Sbjct: 32 GFGMRGQKSRSGRPTRPG 49
>RL15_SYNP6 (Q5N0U8) 50S ribosomal protein L15| Length = 147 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 241 GDGLRGQEASAGRPPQPG 188 G G+RGQ++ +GRP +PG Sbjct: 32 GFGMRGQKSRSGRPTRPG 49
>YQ33_CAEEL (Q09233) Putative cuticle collagen C09G5.3| Length = 283 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 241 GDGLRGQEASAGRPPQPGKRASG 173 G G +G + GRP QPG++A G Sbjct: 182 GKGPQGPPGTPGRPGQPGRKAIG 204
>CYAA_USTMA (P49606) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 2493 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -3 Query: 378 DKTLXIISGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSL 259 D ++S LTSL LNLS++ + L+ L LR L Sbjct: 1524 DDVFSVLSELTSLEVLNLSFNEIFEIPDFSLQTLTKLREL 1563
>ALS2_MOUSE (Q920R0) Alsin (Amyotrophic lateral sclerosis protein 2 homolog)| Length = 1651 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = +3 Query: 90 DAQARSACSTRG----GHIYTWTEGACYRKTTPDARLPGWGG 203 D++ +S+ G G ++ W G+ TP+ RLPGWGG Sbjct: 2 DSKKKSSTEAEGSKERGLVHVWQAGSF--SLTPE-RLPGWGG 40
>MUC2_HUMAN (Q02817) Mucin-2 precursor (Intestinal mucin 2)| Length = 5179 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/34 (29%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 60 CRNSQDYVCTDAQARS-ACSTRGGHIYTWTEGAC 158 C+N++D +C + + AC+ +G ++ W E C Sbjct: 621 CQNNEDCLCAALSSYARACTAKGVMLWGWREHVC 654
>POLA_CHPVU (Q9YTU3) Polyprotein p69 (ORFA polyprotein) [Contains: Papain-like| protease p29 (EC 3.4.22.-); p40 protein] Length = 622 Score = 27.3 bits (59), Expect = 9.2 Identities = 17/57 (29%), Positives = 22/57 (38%), Gaps = 6/57 (10%) Frame = +3 Query: 45 HQINPCRNSQDYVCTDAQARSACSTRGGHIYTWTEGACYRKTTPD------ARLPGW 197 H+ P R S R CS+R G + + +G CY D AR GW Sbjct: 125 HEGLPVRPSYMIARPPRPVRGLCSSRDGSLAQFGQGYCYLSAIVDSARWRVARTTGW 181
>NYX_HUMAN (Q9GZU5) Nyctalopin precursor| Length = 481 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -3 Query: 360 ISGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSLDSCKVTA 232 + GL +L +L R+ L+ L+ LRSLSL + +V A Sbjct: 178 LRGLANLTHAHLERGRIEAVASSSLQGLRRLRSLSLQANRVRA 220
>TLR2_HUMAN (O60603) Toll-like receptor 2 precursor (Toll/interleukin 1| receptor-like protein 4) (CD282 antigen) Length = 784 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -3 Query: 357 SGLTSLVSLNLSYSRVSNAGLHHLRPLQNLRSLSL 253 S L SL L+LSY+ +SN +PL +L L+L Sbjct: 97 SSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNL 131
>MTMR5_HUMAN (O95248) SET-binding factor 1 (Sbf1) (Myotubularin-related protein| 5) Length = 1866 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 257 DSERRFCSGLRWWRPAFDTREYDRFSETKDVRPE 358 +SER +C+ L +W PA ++E R + + E Sbjct: 74 NSERHYCACLTFWEPAEPSQETTRVEDATEREEE 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,710,688 Number of Sequences: 219361 Number of extensions: 890655 Number of successful extensions: 3167 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 2833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3167 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)