| Clone Name | rbasd16o12 |
|---|---|
| Clone Library Name | barley_pub |
>PIP12_ORYSA (Q7XSQ9) Probable aquaporin PIP1.2 (Plasma membrane intrinsic| protein 1.2) (OsPIP1.2) Length = 282 Score = 48.9 bits (115), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRAIPF 164 VGPFIGAALAAIYHQVVIRAIPF Sbjct: 256 VGPFIGAALAAIYHQVVIRAIPF 278
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 48.1 bits (113), Expect = 6e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRAIPF 164 VGPFIGAALAA+YHQVVIRAIPF Sbjct: 264 VGPFIGAALAALYHQVVIRAIPF 286
>PIP11_ORYSA (Q6EU94) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (OsPIP1.1) (Water channel protein RWC1) (RWC-1) Length = 289 Score = 48.1 bits (113), Expect = 6e-06 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRAIPF 164 VGPF+GAALAAIYHQV+IRAIPF Sbjct: 263 VGPFVGAALAAIYHQVIIRAIPF 285
>PIP15_ARATH (Q8LAA6) Probable aquaporin PIP1.5 (Plasma membrane intrinsic| protein 1d) (PIP1d) Length = 287 Score = 47.8 bits (112), Expect = 8e-06 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRAIPF 164 VGPFIGAALAA+YHQ+VIRAIPF Sbjct: 261 VGPFIGAALAALYHQIVIRAIPF 283
>PIP14_ARATH (Q39196) Probable aquaporin PIP1.4 (Plasma membrane intrinsic| protein 1.4) (Transmembrane protein C) (TMP-C) Length = 287 Score = 47.8 bits (112), Expect = 8e-06 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRAIPF 164 VGPFIGAALAA+YHQ+VIRAIPF Sbjct: 261 VGPFIGAALAALYHQIVIRAIPF 283
>PIP13_ARATH (Q08733) Aquaporin PIP1.3 (Plasma membrane intrinsic protein 1c)| (PIP1c) (Transmembrane protein B) (TMP-B) Length = 286 Score = 47.0 bits (110), Expect = 1e-05 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRAIPF 164 VGPFIGAALAA+YHQ+VIRAIPF Sbjct: 260 VGPFIGAALAALYHQLVIRAIPF 282
>PIP13_ORYSA (Q9SXF8) Aquaporin PIP 1.3 (Plasma membrane intrinsic protein 1.3)| (OsPIP1.3) (Water channel protein RWC3) (RWC-3) Length = 288 Score = 46.2 bits (108), Expect = 2e-05 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRAIPF 164 VGPFIGAALAAIYH VVIRAIPF Sbjct: 262 VGPFIGAALAAIYHVVVIRAIPF 284
>PIP11_VICFA (P61838) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 45.4 bits (106), Expect = 4e-05 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRAIPF 164 VGPFIGAALAA+YH VVIRAIPF Sbjct: 260 VGPFIGAALAALYHVVVIRAIPF 282
>PIP11_ARATH (P61837) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 45.4 bits (106), Expect = 4e-05 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRAIPF 164 VGPFIGAALAA+YH VVIRAIPF Sbjct: 260 VGPFIGAALAALYHVVVIRAIPF 282
>PIP12_ARATH (Q06611) Aquaporin PIP1.2 (Plasma membrane intrinsic protein 1b)| (PIP1b) (Transmembrane protein A) (TMP-A) (AthH2) Length = 286 Score = 45.1 bits (105), Expect = 5e-05 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRAIPF 164 VGPFIGAALAA+YH +VIRAIPF Sbjct: 260 VGPFIGAALAALYHVIVIRAIPF 282
>PIP1_LYCES (Q08451) Probable aquaporin PIP-type pTOM75 (Ripening-associated| membrane protein) (RAMP) Length = 286 Score = 44.7 bits (104), Expect = 7e-05 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRAIPF 164 VGP IGAALAAIYHQ++IRA+PF Sbjct: 261 VGPMIGAALAAIYHQIIIRAMPF 283
>PIP25_ORYSA (Q8GRI8) Aquaporin PIP2.5 (Plasma membrane intrinsic protein 2.5)| (OsPIP2.5) Length = 283 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 20/20 (100%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGPFIGAA+AA+YHQ+V+RA Sbjct: 252 VGPFIGAAIAALYHQIVLRA 271
>PIP24_ORYSA (Q8GRT8) Aquaporin PIP2.4 (Plasma membrane intrinsic protein 2.4)| (OsPIP2.4) Length = 286 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 20/20 (100%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGPFIGAA+AA+YHQV++RA Sbjct: 255 VGPFIGAAIAALYHQVILRA 274
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 37.4 bits (85), Expect = 0.011 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGPFIGAA+AA YHQ V+RA Sbjct: 253 VGPFIGAAIAAFYHQFVLRA 272
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 37.4 bits (85), Expect = 0.011 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGPFIGAA+AA YHQ V+RA Sbjct: 251 VGPFIGAAIAAFYHQFVLRA 270
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 37.0 bits (84), Expect = 0.014 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGPF+GAA+AA YHQ V+RA Sbjct: 252 VGPFVGAAIAAFYHQFVLRA 271
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 36.6 bits (83), Expect = 0.018 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGPF+GAA+AA YHQ ++RA Sbjct: 258 VGPFVGAAIAAFYHQYILRA 277
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 35.8 bits (81), Expect = 0.031 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGPFIGA +AA YHQ V+RA Sbjct: 251 VGPFIGATIAAFYHQFVLRA 270
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 35.4 bits (80), Expect = 0.040 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGPF GAA+AA YHQ V+RA Sbjct: 252 VGPFAGAAIAAFYHQFVLRA 271
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 34.7 bits (78), Expect = 0.068 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGP IGAA+AA YHQ V+RA Sbjct: 258 VGPLIGAAIAAAYHQYVLRA 277
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 34.7 bits (78), Expect = 0.068 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGP IGAA+AA YHQ V+RA Sbjct: 257 VGPLIGAAIAAAYHQYVLRA 276
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 33.5 bits (75), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGP IGAA AA YHQ ++RA Sbjct: 253 VGPMIGAAAAAFYHQFILRA 272
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 33.5 bits (75), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGPF+GA AA YHQ V+RA Sbjct: 248 VGPFVGALAAAAYHQYVLRA 267
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGPF+GA AA YHQ ++RA Sbjct: 244 VGPFVGALAAAAYHQYILRA 263
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 32.7 bits (73), Expect = 0.26 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIRA 173 VGPF+GA AA YHQ ++RA Sbjct: 246 VGPFLGALAAAAYHQYILRA 265
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 32.0 bits (71), Expect = 0.44 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -1 Query: 229 GPFIGAALAAIYHQVVIRA 173 GPFIGA AA YHQ ++RA Sbjct: 249 GPFIGALAAAAYHQYILRA 267
>PIP27_ORYSA (Q651D5) Probable aquaporin PIP2.7 (Plasma membrane intrinsic| protein 2.7) (OsPIP2.7) Length = 290 Score = 30.4 bits (67), Expect = 1.3 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIR 176 VGP IGA LAA YH++V+R Sbjct: 255 VGPVIGAFLAAAYHKLVLR 273
>PIP28_ORYSA (Q7Y1E6) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 2.8) (OsPIP2.8) Length = 280 Score = 30.0 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 232 VGPFIGAALAAIYHQVVIR 176 VGPF GAA A IYH ++R Sbjct: 245 VGPFAGAAAAMIYHHYILR 263
>PEPA_BOVIN (P00792) Pepsin A precursor (EC 3.4.23.1)| Length = 372 Score = 28.9 bits (63), Expect = 3.7 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +2 Query: 44 TDDGKRGPPPSESKFTQKHAVCSSGWDGIFLCSSS 148 T +G + P P + Q + +CSSG++G+ + +SS Sbjct: 307 TINGVQYPVPPSAYILQSNGICSSGFEGMDISTSS 341
>DOF14_ARATH (Q9FZA4) Hypothetical Dof zinc finger protein DOF1.4 (AtDOF1.4)| Length = 311 Score = 28.5 bits (62), Expect = 4.9 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 6/48 (12%) Frame = +2 Query: 68 PPSESKFTQKHAVCSS-GWDGIFLCS-----SSLGLGLEWDRSDDHLV 193 P S+F+ CSS G + FL S S+LGLGL S DH + Sbjct: 137 PMIPSRFSDSSKTCSSSGLESEFLSSGFSSLSALGLGLPHQMSHDHTI 184
>SERR_DROME (P18168) Serrate protein precursor (Protein beaded)| Length = 1404 Score = 28.1 bits (61), Expect = 6.4 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 32 FHGNTDDGKRGPPPSESKFTQKHAVCSSGWDGIFLCSSSL 151 + G +G P + K Q H C+ GW G+F C+ ++ Sbjct: 838 YAGQCQNGGTCMPGAPDKALQPHCRCAPGWTGLF-CAEAI 876 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,398,292 Number of Sequences: 219361 Number of extensions: 687140 Number of successful extensions: 1945 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 1927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1945 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)