| Clone Name | rbasd16o08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | G13B_DICDI (P34116) Cell surface glycoprotein gp138B precursor | 33 | 0.72 | 2 | G3ST2_HUMAN (Q9H3Q3) Galactose-3-O-sulfotransferase 2 (EC 2.8.2.... | 30 | 4.6 | 3 | G3ST2_PIG (Q6XQG9) Galactose 3-O-sulfotransferase 2 (EC 2.8.2.-)... | 30 | 7.9 |
|---|
>G13B_DICDI (P34116) Cell surface glycoprotein gp138B precursor| Length = 734 Score = 33.1 bits (74), Expect = 0.72 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +3 Query: 270 SHVQENFL*LSQNQVLRSSGSCKLSQGGNHAGSCALPEHLL 392 S+ + N+L L+ NQ+ ++ SC L GGN G LP LL Sbjct: 377 SYCRINYLGLNYNQLNGTAPSCILCLGGNRGGDIVLPNPLL 417
>G3ST2_HUMAN (Q9H3Q3) Galactose-3-O-sulfotransferase 2 (EC 2.8.2.-) (Gal3ST-2)| (Galbeta1-3GalNAc 3'-sulfotransferase 2) (Beta-galactose-3-O-sulfotransferase 2) (Glycoprotein beta-Gal 3'-sulfotransferase 2) Length = 398 Score = 30.4 bits (67), Expect = 4.6 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +3 Query: 93 GIARLPTATSVVFMVVFIAASSFHPSTFHHLAEEQILSICLPCMDLIHAGH 245 G A P T+++F+ ASS + + AE LS+ LP +H G+ Sbjct: 44 GQAEGPPVTNIMFLKTHKTASSTVLNILYRFAETHNLSVALPAGSRVHLGY 94
>G3ST2_PIG (Q6XQG9) Galactose 3-O-sulfotransferase 2 (EC 2.8.2.-) (Gal3ST-2)| (Galbeta1-3GalNAc 3'-sulfotransferase 2) (Beta-galactose-3-O-sulfotransferase 2) Length = 398 Score = 29.6 bits (65), Expect = 7.9 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = +3 Query: 84 LRHGIARLPTATSVVFMVVFIAASSFHPSTFHHLAEEQILSICLPCMDLIHAGH 245 L G A P T+V+F+ ASS + AE LS+ LP +H G+ Sbjct: 39 LLKGQAEGPPITNVMFLKTHKTASSTVLNILFRFAETHNLSVALPAGQRVHLGY 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,938,470 Number of Sequences: 219361 Number of extensions: 1922294 Number of successful extensions: 4502 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4500 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)