| Clone Name | rbasd17c24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | WNT7_STRPU (P28098) Protein Wnt-7 (Fragment) | 29 | 4.1 |
|---|
>WNT7_STRPU (P28098) Protein Wnt-7 (Fragment)| Length = 123 Score = 28.9 bits (63), Expect = 4.1 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +3 Query: 30 AERTXKSTKRKQKPAENHRFPLFQHLHIYLHQT 128 A+RT + T K K +EN+R P HL ++LH++ Sbjct: 38 AKRTRRPTFLKVKDSENYRKPRLSHL-VFLHRS 69 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,987,668 Number of Sequences: 219361 Number of extensions: 169208 Number of successful extensions: 511 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 80,573,946 effective HSP length: 18 effective length of database: 76,625,448 effective search space used: 1839010752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)