| Clone Name | rbasd16n13 |
|---|---|
| Clone Library Name | barley_pub |
>DLTA_BACSU (P39581) D-alanine--poly(phosphoribitol) ligase subunit 1 (EC| 6.1.1.13) (D-alanine-activating enzyme) (DAE) (D-alanine-D-alanyl carrier protein ligase) (DCL) Length = 503 Score = 33.5 bits (75), Expect = 0.59 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = -1 Query: 223 KLFMSAAEFARSLSIYTVFLCLRCGGMLYCV 131 K+F++ A F+ LS+ ++ CL+ GG L+CV Sbjct: 185 KIFLNQAPFSFDLSVMDLYPCLQSGGTLHCV 215
>NADD_BUCAP (Q8K9B7) Probable nicotinate-nucleotide adenylyltransferase (EC| 2.7.7.18) (Deamido-NAD(+) pyrophosphorylase) (Deamido-NAD(+) diphosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) Length = 216 Score = 31.2 bits (69), Expect = 2.9 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = +3 Query: 147 PPHRKHKKTVYIDKLLANSAALMNNFSGAAHDRVELSPLQSSTAKSHSTGYGVRLYPKSK 326 PPHR KT ID+L A+ +N +L + K ++T Y + K + Sbjct: 43 PPHRSKTKTSIIDRLKMIKFAIKDN---------KLFTISYLETKKNTTFYTIETLKKIR 93 Query: 327 RKI-YISPL 350 +KI Y+ PL Sbjct: 94 KKIGYLQPL 102
>GLYA_BLOPB (Q492D5) Serine hydroxymethyltransferase (EC 2.1.2.1) (Serine| methylase) (SHMT) Length = 416 Score = 30.4 bits (67), Expect = 5.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 423 TAEITTIIPHSSKRILYSIANLLSHRENLYLGRHVNH 533 +A+ I PHS + +S+ N L H + L H+NH Sbjct: 83 SADYANIQPHSGSQANFSVYNALLHPGDTILSMHLNH 119
>HUTH_CAEEL (Q20502) Probable histidine ammonia-lyase (EC 4.3.1.3) (Histidase)| Length = 677 Score = 29.6 bits (65), Expect = 8.5 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 6/66 (9%) Frame = +3 Query: 156 RKHKKTVYIDKLLANSAAL------MNNFSGAAHDRVELSPLQSSTAKSHSTGYGVRLYP 317 R K +++K+ + A+ FS +L LQ + +SH+TGYG L P Sbjct: 161 RIRKARTFLEKIASEHRAVYGVTTGFGTFSNVTIPPEKLKKLQLNLIRSHATGYGEPLAP 220 Query: 318 KSKRKI 335 R + Sbjct: 221 NRARML 226
>PTK2_CANGA (Q6FRE7) Serine/threonine-protein kinase PTK2 (EC 2.7.11.1)| Length = 777 Score = 29.6 bits (65), Expect = 8.5 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 311 ISKVQKENIYITTSLLLVKARTTIYLRQG 397 I+K NI+IT++ LVK TTIY +G Sbjct: 275 IAKQLSNNIHITSTFYLVKVPTTIYTTRG 303 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,646,491 Number of Sequences: 219361 Number of extensions: 2057476 Number of successful extensions: 4615 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4614 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6427774254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)