| Clone Name | rbasd17b01 |
|---|---|
| Clone Library Name | barley_pub |
>AVP_HORVU (Q06572) Pyrophosphate-energized vacuolar membrane proton pump (EC| 3.6.1.1) (Pyrophosphate-energized inorganic pyrophosphatase) (H(+)-PPase) Length = 762 Score = 68.2 bits (165), Expect(2) = 6e-18 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFFATYGGLLFKYI 316 GPSLNILIKLMAVESLVFAPFFATYGGLLFKYI Sbjct: 730 GPSLNILIKLMAVESLVFAPFFATYGGLLFKYI 762 Score = 41.6 bits (96), Expect(2) = 6e-18 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 515 NSEHARSLGPKGSDCHK 465 NSEHARSLGPKGSDCHK Sbjct: 697 NSEHARSLGPKGSDCHK 713 Score = 39.7 bits (91), Expect = 0.005 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 493 LVPRVQTATRAAVIGDTIGDPLKDTSRP 410 L P+ +AAVIGDTIGDPLKDTS P Sbjct: 704 LGPKGSDCHKAAVIGDTIGDPLKDTSGP 731
>AVP1_ARATH (P31414) Pyrophosphate-energized vacuolar membrane proton pump 1| (EC 3.6.1.1) (Pyrophosphate-energized inorganic pyrophosphatase 1) (H(+)-PPase 1) (Vacuolar proton pyrophosphatase 1) (Vacuolar proton pyrophosphatase 3) Length = 770 Score = 63.9 bits (154), Expect(2) = 5e-16 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFFATYGGLLFKY 319 GPSLNILIKLMAVESLVFAPFFAT+GG+LFKY Sbjct: 738 GPSLNILIKLMAVESLVFAPFFATHGGILFKY 769 Score = 39.3 bits (90), Expect(2) = 5e-16 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 493 LVPRVQTATRAAVIGDTIGDPLKDTSRP 410 L P+ +AAVIGDTIGDPLKDTS P Sbjct: 712 LGPKGSEPHKAAVIGDTIGDPLKDTSGP 739 Score = 32.0 bits (71), Expect = 1.0 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 512 SEHARSLGPKGSDCHK 465 SEHA+SLGPKGS+ HK Sbjct: 706 SEHAKSLGPKGSEPHK 721
>AVP_PHAAU (P21616) Pyrophosphate-energized vacuolar membrane proton pump (EC| 3.6.1.1) (Pyrophosphate-energized inorganic pyrophosphatase) (H(+)-PPase) (Vacuolar H(+)-pyrophosphatase) Length = 764 Score = 62.0 bits (149), Expect(2) = 1e-15 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFFATYGGLLFK 322 GPSLNILIKLMAVESLVFAPFFAT+GGLLFK Sbjct: 732 GPSLNILIKLMAVESLVFAPFFATHGGLLFK 762 Score = 39.7 bits (91), Expect(2) = 1e-15 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 493 LVPRVQTATRAAVIGDTIGDPLKDTSRP 410 L P+ +AAVIGDTIGDPLKDTS P Sbjct: 706 LGPKGSDCHKAAVIGDTIGDPLKDTSGP 733 Score = 39.3 bits (90), Expect = 0.006 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 512 SEHARSLGPKGSDCHK 465 SEHARSLGPKGSDCHK Sbjct: 700 SEHARSLGPKGSDCHK 715
>HPPA_LEPIN (Q8F641) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 704 Score = 49.7 bits (117), Expect(2) = 8e-11 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFFATYGGLLFK 322 GPS+NILIKLMA+ SLVFA FF GGL+FK Sbjct: 671 GPSINILIKLMAITSLVFAEFFVQQGGLIFK 701 Score = 35.8 bits (81), Expect(2) = 8e-11 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -3 Query: 466 RAAVIGDTIGDPLKDTSRP 410 +AAV+GDT+GDP KDTS P Sbjct: 654 KAAVVGDTVGDPFKDTSGP 672
>HPPA_LEPIC (Q72Q29) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 704 Score = 49.7 bits (117), Expect(2) = 8e-11 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFFATYGGLLFK 322 GPS+NILIKLMA+ SLVFA FF GGL+FK Sbjct: 671 GPSINILIKLMAITSLVFAEFFVQQGGLIFK 701 Score = 35.8 bits (81), Expect(2) = 8e-11 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -3 Query: 466 RAAVIGDTIGDPLKDTSRP 410 +AAV+GDT+GDP KDTS P Sbjct: 654 KAAVVGDTVGDPFKDTSGP 672
>HPPA_CLOTE (Q898Q9) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 673 Score = 45.1 bits (105), Expect(2) = 1e-09 Identities = 21/33 (63%), Positives = 24/33 (72%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFFATYGGLLFKYI 316 GPS+NILIKLM + SLVFAP YGG+L I Sbjct: 640 GPSMNILIKLMTIVSLVFAPVVLQYGGILLNLI 672 Score = 36.6 bits (83), Expect(2) = 1e-09 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +AAV+GDT+GDP KDTS P Sbjct: 621 AHKAAVVGDTVGDPFKDTSGP 641
>HPPA_FUSNN (Q8RHJ2) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 671 Score = 36.2 bits (82), Expect(2) = 7e-07 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFFATY 340 GPSLNILIKLM++ SLV P F + Sbjct: 646 GPSLNILIKLMSIVSLVLVPLFVKF 670 Score = 35.8 bits (81), Expect(2) = 7e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -3 Query: 466 RAAVIGDTIGDPLKDTSRP 410 +AAV+GDT+GDP KDTS P Sbjct: 629 KAAVVGDTVGDPFKDTSGP 647
>HPPA1_METMA (Q8PYZ8) Pyrophosphate-energized proton pump 1 (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase 1) (H+-PPase 1) (Membrane-bound proton-translocating pyrophosphatase 1) Length = 676 Score = 36.2 bits (82), Expect(2) = 7e-06 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFF 349 GP++NILIKLM++ +LVFAP F Sbjct: 654 GPAINILIKLMSIVALVFAPLF 675 Score = 32.3 bits (72), Expect(2) = 7e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +A V GDT+GDP KDT+ P Sbjct: 635 AHKAGVTGDTVGDPFKDTAGP 655
>HPPA1_METAC (Q8TJA9) Pyrophosphate-energized proton pump 1 (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase 1) (H+-PPase 1) (Membrane-bound proton-translocating pyrophosphatase 1) Length = 676 Score = 35.0 bits (79), Expect(2) = 2e-05 Identities = 14/22 (63%), Positives = 20/22 (90%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFF 349 GP++NILIKLM++ ++VFAP F Sbjct: 654 GPAINILIKLMSIVAVVFAPLF 675 Score = 32.3 bits (72), Expect(2) = 2e-05 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +A V GDT+GDP KDT+ P Sbjct: 635 AHKAGVTGDTVGDPFKDTAGP 655
>AVP2_ARATH (Q56ZN6) Pyrophosphate-energized membrane proton pump 2 (EC| 3.6.1.1) (Pyrophosphate-energized inorganic pyrophosphatase 2) (H(+)-PPase 2) (Vacuolar proton pyrophosphatase 2) (AVP1-like protein 1) Length = 802 Score = 34.7 bits (78), Expect(2) = 9e-05 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = -3 Query: 499 GPLVPRVQTATRAAVIGDTIGDPLKDTSRP 410 G L + A +AAV GDT+GDP KDT+ P Sbjct: 752 GALGGKGSEAHKAAVTGDTVGDPFKDTAGP 781 Score = 30.0 bits (66), Expect(2) = 9e-05 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFF 349 GPS+++LIK++A +LV AP F Sbjct: 780 GPSIHVLIKMLATITLVMAPVF 801
>AVPX_ARATH (Q9FWR2) Putative pyrophosphate-energized membrane proton pump 3| (EC 3.6.1.1) (Pyrophosphate-energized inorganic pyrophosphatase 3) (H(+)-PPase 3) (AVP1-like protein 2) Length = 802 Score = 33.5 bits (75), Expect(2) = 2e-04 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -3 Query: 499 GPLVPRVQTATRAAVIGDTIGDPLKDTSRP 410 G L + + +AAV GDT+GDP KDT+ P Sbjct: 752 GALGGKGSDSHKAAVTGDTVGDPFKDTAGP 781 Score = 30.4 bits (67), Expect(2) = 2e-04 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFF 349 GPS+++LIK++A +LV AP F Sbjct: 780 GPSIHVLIKMLATITLVMAPIF 801
>HPPA_BACTN (Q8A294) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 734 Score = 34.3 bits (77), Expect(2) = 2e-04 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -3 Query: 466 RAAVIGDTIGDPLKDTSRP 410 +A V+GDT+GDP KDTS P Sbjct: 690 KATVVGDTVGDPFKDTSGP 708 Score = 29.3 bits (64), Expect(2) = 2e-04 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFA 358 GPSLNILIKLM++ ++V A Sbjct: 707 GPSLNILIKLMSMVAIVMA 725
>HPPA_THETN (Q8RCX1) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 711 Score = 34.3 bits (77), Expect(2) = 4e-04 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +A+V+GDT+GDP KDT+ P Sbjct: 670 AHKASVVGDTVGDPFKDTAGP 690 Score = 28.1 bits (61), Expect(2) = 4e-04 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFF 349 GPSL++LIKL++ +LVF F Sbjct: 689 GPSLHVLIKLISTITLVFVALF 710
>HPPA2_METMA (Q8PYZ7) Pyrophosphate-energized proton pump 2 (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase 2) (H+-PPase 2) (Membrane-bound proton-translocating pyrophosphatase 2) Length = 671 Score = 36.6 bits (83), Expect(2) = 7e-04 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A RAAV+GDT+GDP KDT+ P Sbjct: 625 AHRAAVVGDTVGDPFKDTAGP 645 Score = 25.0 bits (53), Expect(2) = 7e-04 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFFATYGGL 331 GP+LN LIK++ + +++F+P G L Sbjct: 644 GPALNSLIKVVNMVAILFSPLIIGGGFL 671
>HPPA_THEMA (Q9S5X0) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 726 Score = 33.5 bits (75), Expect(2) = 0.001 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 466 RAAVIGDTIGDPLKDTSRP 410 +A VIGDT+GDPLKDT P Sbjct: 682 KALVIGDTVGDPLKDTVGP 700 Score = 27.7 bits (60), Expect(2) = 0.001 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFF 349 GPSL+ILIK+M+V S++ F Sbjct: 699 GPSLDILIKIMSVVSVIAVSIF 720
>HPPA_PYRAE (Q8ZWI8) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 721 Score = 34.7 bits (78), Expect(2) = 0.006 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -3 Query: 466 RAAVIGDTIGDPLKDTSRP 410 +AAVIGDT+GDP+KDT P Sbjct: 666 KAAVIGDTVGDPMKDTVGP 684 Score = 23.9 bits (50), Expect(2) = 0.006 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVF 361 GPSLN LIK++ S+VF Sbjct: 683 GPSLNPLIKVLNTLSVVF 700
>HPPA_MYXXA (Q93NB7) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) (Fragment) Length = 275 Score = 33.5 bits (75), Expect(2) = 0.006 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -3 Query: 466 RAAVIGDTIGDPLKDTSRP 410 +AAV+GD +GDP KDTS P Sbjct: 234 KAAVVGDMVGDPFKDTSGP 252 Score = 25.0 bits (53), Expect(2) = 0.006 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAPFFA 346 GP + ILIK+M+V SL+ A A Sbjct: 251 GPGVAILIKVMSVVSLLVASLIA 273
>HPPA2_METAC (Q8TJA8) Pyrophosphate-energized proton pump 2 (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase 2) (H+-PPase 2) (Membrane-bound proton-translocating pyrophosphatase 2) Length = 671 Score = 35.8 bits (81), Expect(2) = 0.007 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -3 Query: 484 RVQTATRAAVIGDTIGDPLKDTSRP 410 R A +AAV+GDT+GDP KDT+ P Sbjct: 621 RGSEAHKAAVVGDTVGDPFKDTAGP 645 Score = 22.3 bits (46), Expect(2) = 0.007 Identities = 8/19 (42%), Positives = 16/19 (84%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFA 358 GP+LN LIK++ + +++F+ Sbjct: 644 GPALNALIKVVNMVAILFS 662
>HPPA2_RHOPA (Q8KY01) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 725 Score = 34.3 bits (77), Expect(2) = 0.020 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = -3 Query: 499 GPLVPRVQTATRAAVIGDTIGDPLKDTSRP 410 G L + A +AAV GDT+GDP KDT+ P Sbjct: 634 GVLHKKGSEAHKAAVTGDTVGDPYKDTAGP 663 Score = 22.3 bits (46), Expect(2) = 0.020 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAP 355 GP++N LIK++ + +L+ P Sbjct: 662 GPAVNPLIKIINIVALLIVP 681
>MAGD1_MOUSE (Q9QYH6) Melanoma-associated antigen D1 (MAGE-D1 antigen)| (Neurotrophin receptor-interacting MAGE homolog) (Dlxin-1) Length = 775 Score = 37.4 bits (85), Expect = 0.025 Identities = 22/74 (29%), Positives = 35/74 (47%) Frame = +1 Query: 193 PGMTLTTKNNSSAQRTKAGGQAGGGVIRDSVCRSSLDSSPLDVLEQQTSVRGEEGREHEG 372 PG T+N + A+ G AG + ++S D S +E +T +RG+ R+ Sbjct: 190 PGADAQTQNVNQAKMADVGTSAGISEADGAAAQTSADGSQTQNVESRTIIRGKRTRKVNN 249 Query: 373 LNGHELDEDVERRA 414 LN E + +RRA Sbjct: 250 LNVEENNSGDQRRA 263
>MAGD1_RAT (Q9ES73) Melanoma-associated antigen D1 (MAGE-D1 antigen)| (Neurotrophin receptor-interacting MAGE homolog) (Sertoli cell necdin-related gene 1) (SNERG-1) Length = 775 Score = 37.0 bits (84), Expect = 0.032 Identities = 22/74 (29%), Positives = 34/74 (45%) Frame = +1 Query: 193 PGMTLTTKNNSSAQRTKAGGQAGGGVIRDSVCRSSLDSSPLDVLEQQTSVRGEEGREHEG 372 PG T+N + A+ G AG + ++S D S +E +T +RG+ R+ Sbjct: 192 PGADAQTQNVNQAKMADVGTSAGISETDGAAAQTSADGSQAQNVESRTIIRGKRTRKINN 251 Query: 373 LNGHELDEDVERRA 414 LN E +RRA Sbjct: 252 LNVEENSNGDQRRA 265
>HPPA_NITEU (Q82TF3) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 685 Score = 33.5 bits (75), Expect(2) = 0.033 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +AAV GDT+GDP KDT+ P Sbjct: 645 AHKAAVTGDTVGDPYKDTAGP 665 Score = 22.3 bits (46), Expect(2) = 0.033 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAP 355 GP++N LIK++ + +L+ P Sbjct: 664 GPAINPLIKIINIVALLIIP 683
>HPPA_XANCP (Q8P5M6) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 675 Score = 33.1 bits (74), Expect(2) = 0.033 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +AA+ GDT+GDP KDT+ P Sbjct: 635 AHKAAITGDTVGDPYKDTAGP 655 Score = 22.7 bits (47), Expect(2) = 0.033 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAP 355 GP++N LIK++ + +L+ P Sbjct: 654 GPAINPLIKIINIVALLLVP 673
>HPPA_XANAC (Q8PH20) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 675 Score = 33.1 bits (74), Expect(2) = 0.033 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +AA+ GDT+GDP KDT+ P Sbjct: 635 AHKAAITGDTVGDPYKDTAGP 655 Score = 22.7 bits (47), Expect(2) = 0.033 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -1 Query: 414 GPSLNILIKLMAVESLVFAP 355 GP++N LIK++ + +L+ P Sbjct: 654 GPAINPLIKIINIVALLLVP 673
>MDTA_SALTY (Q8ZNQ3) Multidrug resistance protein mdtA precursor (Multidrug| transporter mdtA) Length = 413 Score = 34.3 bits (77), Expect = 0.21 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 13/82 (15%) Frame = +1 Query: 175 VGNRGNPGMTLTTKNNSSAQRTK------------AGGQAGGGVIRDSVCRSSLDSSPLD 318 +GN G+ L +NN S +R K AG AG V+ D + R + + + ++ Sbjct: 330 MGNEGHFVWVLNDENNVSKKRVKIGIQDNRNVVISAGLSAGDRVVTDGIDRLT-EGAKVE 388 Query: 319 VLEQQTSVRGEEG-REHEGLNG 381 V+E QT+V E+ HEG G Sbjct: 389 VVEPQTTVADEKSPSRHEGQKG 410
>HPPA_CAUCR (Q9A8J0) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 712 Score = 33.9 bits (76), Expect = 0.27 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -3 Query: 466 RAAVIGDTIGDPLKDTSRP 410 +AAV GDT+GDP KDTS P Sbjct: 670 KAAVTGDTVGDPYKDTSGP 688
>HPPA_RHORT (O68460) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 702 Score = 33.5 bits (75), Expect = 0.35 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +AAV GDT+GDP KDT+ P Sbjct: 660 AHKAAVTGDTVGDPYKDTAGP 680
>HPPA1_RHOPA (P60363) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 706 Score = 33.5 bits (75), Expect = 0.35 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +AAV GDT+GDP KDT+ P Sbjct: 664 AHKAAVTGDTVGDPYKDTAGP 684
>HPPA_STRCO (Q9X913) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 794 Score = 33.1 bits (74), Expect = 0.46 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A A VIGDT+GDP KDT+ P Sbjct: 696 AHAATVIGDTVGDPFKDTAGP 716
>MDTA_SALTI (Q8Z5F8) Multidrug resistance protein mdtA precursor (Multidrug| transporter mdtA) Length = 413 Score = 33.1 bits (74), Expect = 0.46 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 13/82 (15%) Frame = +1 Query: 175 VGNRGNPGMTLTTKNNSSAQRTK------------AGGQAGGGVIRDSVCRSSLDSSPLD 318 +GN G+ L +NN S +R K AG AG V+ D + R + + + ++ Sbjct: 330 MGNEGHFVWVLNDENNVSKKRVKIGIQDNRNVVISAGLSAGDRVVTDGIDRLT-EGAKVE 388 Query: 319 VLEQQTSVRGEEG-REHEGLNG 381 V+E QT++ E+ HEG G Sbjct: 389 VVEPQTTMADEKSPSRHEGQKG 410
>HPPA_STRAW (Q82EJ8) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 801 Score = 33.1 bits (74), Expect = 0.46 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A A VIGDT+GDP KDT+ P Sbjct: 703 AHAATVIGDTVGDPFKDTAGP 723
>HPPA_CHLTE (Q8KDT8) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 750 Score = 32.3 bits (72), Expect = 0.79 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -3 Query: 463 AAVIGDTIGDPLKDTSRPVAQHP 395 A+V+GDT+GDP KDTS VA +P Sbjct: 676 ASVVGDTVGDPFKDTS-SVALNP 697
>HPPA_RHIME (Q8VRZ3) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 711 Score = 32.3 bits (72), Expect = 0.79 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +A+V GDT+GDP KDT+ P Sbjct: 670 AHKASVTGDTVGDPYKDTAGP 690
>HPPA_BRUSU (Q8G1E6) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 718 Score = 32.3 bits (72), Expect = 0.79 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +A+V GDT+GDP KDT+ P Sbjct: 674 AHKASVTGDTVGDPYKDTAGP 694
>HPPA_BRUME (Q8YGH4) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 718 Score = 32.3 bits (72), Expect = 0.79 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +A+V GDT+GDP KDT+ P Sbjct: 674 AHKASVTGDTVGDPYKDTAGP 694
>HPPA_BRAJA (Q89K83) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 706 Score = 32.3 bits (72), Expect = 0.79 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A ++AV GDT+GDP KDT+ P Sbjct: 664 AHKSAVTGDTVGDPYKDTAGP 684
>HPPA_RHILO (Q983A3) Pyrophosphate-energized proton pump (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 713 Score = 32.3 bits (72), Expect = 0.79 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +A+V GDT+GDP KDT+ P Sbjct: 670 AHKASVTGDTVGDPYKDTAGP 690
>HPPA_AGRT5 (Q8UG67) Pyrophosphate-energized proton pump precursor (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase) (H+-PPase) (Membrane-bound proton-translocating pyrophosphatase) Length = 714 Score = 32.3 bits (72), Expect = 0.79 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +A+V GDT+GDP KDT+ P Sbjct: 672 AHKASVTGDTVGDPYKDTAGP 692
>HPPA1_MYCDI (Q93AR8) Pyrophosphate-energized proton pump 1 (EC 3.6.1.1)| (Pyrophosphate-energized inorganic pyrophosphatase 1) (H+-PPase 1) (Membrane-bound proton-translocating pyrophosphatase 1) (Fragment) Length = 225 Score = 32.3 bits (72), Expect = 0.79 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 472 ATRAAVIGDTIGDPLKDTSRP 410 A +A+V GDT+GDP KDT+ P Sbjct: 197 AHKASVTGDTVGDPYKDTAGP 217
>UBX_MUSDO (Q25451) Homeotic protein ultrabithorax (Fragment)| Length = 248 Score = 31.6 bits (70), Expect = 1.3 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +1 Query: 163 GERGVGNRGNPGMTLTTKNNSSAQRTKAGGQAGGG---VIRDSVC 288 G G G G+ G N ++ Q T GG AGGG +R S C Sbjct: 115 GGTGGGGGGSAGSANGANNTANGQNTSGGGGAGGGGGMPVRPSAC 159
>MSL3_DROVI (Q9NBL2) Protein male-specific lethal-3| Length = 543 Score = 30.0 bits (66), Expect = 3.9 Identities = 19/66 (28%), Positives = 28/66 (42%) Frame = +1 Query: 172 GVGNRGNPGMTLTTKNNSSAQRTKAGGQAGGGVIRDSVCRSSLDSSPLDVLEQQTSVRGE 351 G GNR G +++NSS ++ + GG D RS+ L V + T Sbjct: 184 GSGNRSRDGSGNRSRDNSSGRKKQRDKSKGGDKNDDGERRSARSQFSLHVSPKDTHTTDA 243 Query: 352 EGREHE 369 E R H+ Sbjct: 244 EKRIHQ 249
>MAGD1_PIG (Q6ITT4) Melanoma-associated antigen D1 (MAGE-D1 antigen)| Length = 784 Score = 29.6 bits (65), Expect = 5.1 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 8/83 (9%) Frame = +1 Query: 202 TLTTKNNSSAQRTKAGGQA------GGGVIRD--SVCRSSLDSSPLDVLEQQTSVRGEEG 357 T T+ + Q A QA G G+ + ++S D S LE +T +RG+ Sbjct: 196 TAETQTQNINQAKMATSQADIEADPGPGICESDGAAAQTSADGSQAQNLESRTIIRGKRT 255 Query: 358 REHEGLNGHELDEDVERRALRCP 426 R+ LN E +RRA P Sbjct: 256 RKINNLNVEESSSGDQRRAPLAP 278
>PRXC_STRLI (P49323) Non-heme chloroperoxidase (EC 1.11.1.10) (Chloride| peroxidase) (CPO-L) (Chloroperoxidase L) Length = 275 Score = 29.6 bits (65), Expect = 5.1 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = -1 Query: 162 WPLEGVMLVSPLHYRLVAPCSRRERPDVLPRWYVPGKFSSSHDDDDNVXP 13 W L+G+M + HY +A S + D L R VP +H DD V P Sbjct: 183 WWLQGMMGAANAHYECIAAFSETDFTDDLKRIDVP--VLVAHGTDDQVVP 230
>SYG_METTH (O27874) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 565 Score = 29.6 bits (65), Expect = 5.1 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 313 LDVLEQQTSVRGEEGREHEGLNGHELDEDVERRALRCP 426 +DV + GR+ EGL EL E + +RCP Sbjct: 94 MDVYRADHIIEDATGRDVEGLENQELTEIISDEGIRCP 131
>S2A4R_HUMAN (Q9NR83) SLC2A4 regulator (GLUT4 enhancer factor) (GEF) (Huntington| disease gene regulatory region-binding protein 1) (HDBP-1) Length = 387 Score = 29.6 bits (65), Expect = 5.1 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -2 Query: 299 SDDLQTLSRITPPPACPPAFVRCALLLFLVVNVIPGLPRLPTPLSP 162 +D L +L+ ++P + PPAF R L L +P R P P P Sbjct: 254 TDGLSSLTPVSPTASMPPAFPRLELPELLEPPALPSPLRPPAPPLP 299
>FRQ_SORFI (Q09033) Frequency clock protein| Length = 997 Score = 29.3 bits (64), Expect = 6.7 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 4/63 (6%) Frame = -1 Query: 195 RIAAV-TYPPFPWPLEGVMLVSPLHYRLVAPCSRRERPDVLP---RWYVPGKFSSSHDDD 28 R+A++ T P P P ++++PL VA R P LP +Y P SS DD Sbjct: 815 RLASIRTSSPLPPPRSRNLILAPLQIEYVAGEFHRLNPASLPPPAMFYPPFSTDSSWDDG 874 Query: 27 DNV 19 D++ Sbjct: 875 DDL 877
>GPR62_HUMAN (Q9BZJ7) Probable G-protein coupled receptor 62 (hGPCR8)| Length = 368 Score = 29.3 bits (64), Expect = 6.7 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 290 LQTLSRITPPPACPPAFVRCALL 222 L LS + PPPA PPA RC++L Sbjct: 143 LGALSLLGPPPAPPPAPARCSVL 165
>NMDE3_RAT (Q00961) Glutamate [NMDA] receptor subunit epsilon 3 precursor| (N-methyl D-aspartate receptor subtype 2C) (NR2C) (NMDAR2C) Length = 1237 Score = 29.3 bits (64), Expect = 6.7 Identities = 28/92 (30%), Positives = 32/92 (34%), Gaps = 7/92 (7%) Frame = -3 Query: 499 GPLVPRVQTATRAAVIGDTIGDPLKDTSRPVAQHPHQAH-----GR*VPRVRALLRHV-- 341 G P + A + T G PL D SRP +H A G P V A R Sbjct: 958 GGRTPLARRAPQPPARPATCGPPLPDVSRPSCRHASDARWPVRVGHQGPHVSASERRALP 1017 Query: 340 RRSAVQVHLEDSSRAMIYRHCHE*LPRLPARP 245 RS + H SS R LP P P Sbjct: 1018 ERSLLPAHCHYSSFPRAERSGRPYLPLFPEPP 1049
>CI079_HUMAN (Q6ZUB1) Protein C9orf79| Length = 1445 Score = 28.9 bits (63), Expect = 8.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 Query: 439 GDPLKDTSRPVAQHPHQAHGR 377 GDPL D +PV HQ HG+ Sbjct: 159 GDPLGDVCKPVPAKAHQPHGK 179 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,808,188 Number of Sequences: 219361 Number of extensions: 1681085 Number of successful extensions: 5607 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 5309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5601 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)